>cd00818 IleRS_core This is the catalytic core domain of isoleucine amino-acyl tRNA synthetases (IleRS) . This class I enzyme is a monomer, which aminoacylates the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding. IleRS has an insertion in the core domain, which is subject to both deletions and rearrangements. This editing region hydrolyzes mischarged cognate tRNAs and thus prevents the incorporation of chemically similar amino acids.

Probab=99.55 E-value=2.6e-13 Score=112.36 Aligned_cols=53 Identities=21% Similarity=0.232 Sum_probs=43.8 Q ss_pred ECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCEEECCCCCCHHHHH Q ss_conf 00223443224411777778568999999998506664102014775314555 Q gi|254780285|r 124 NIEFVSANPTGPMHVGHCRCAVVGDTLASLMAFSGYEVTREYYINDAGAQINT 176 (586) Q Consensus 124 vVE~sSpNp~KplHVGHlRsaiIGdsi~ril~~~G~~V~r~nyvgD~G~Q~~~ 176 (586) T Consensus 4 ~~~~~pPYaNg~pHiGHa~~~i~aDv~aRy~Rl~G~~v~f~~GtDeHG~pIe~ 56 (339) T cd00818 4 VFHDGPPYANGLPHYGHALNKILKDIINRYKTMQGYYVPRRPGWDCHGLPIEL 56 (339) T ss_pred EEECCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHH T ss_conf 99589988578734558899999999999998069988778851440399999

HHsearch alignment for GI: 254780285 and conserved domain: cd00818