RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780285|ref|YP_003064698.1| arginyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] (586 letters) >gnl|CDD|30368 COG0018, ArgS, Arginyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]. Length = 577 Score = 476 bits (1226), Expect = e-135 Identities = 207/615 (33%), Positives = 309/615 (50%), Gaps = 68/615 (11%) Query: 1 MYLFADFSSRLKNYLKEIDCKIKVEKKILDRIVIERPRDCAHGHLSTNAAMILSRPLGLD 60 M + ++ L I++E P+D HG +TN A L++ LG + Sbjct: 1 MNIKQLLKEKIAEALSAA-----GLDVEEIEILVEPPKDPEHGDFATNIAFQLAKKLGKN 55 Query: 61 PLTIAELIVARIKIDPDVDSVFIAGKGFINLYLSPSYLRKILSSIVVSGIE-YGRNLIGK 119 P IAE I ++ D ++ V IAG GFIN +LSP +L ++L I+ G + YGR+ +GK Sbjct: 56 PREIAEEIAEKLDTDEIIEKVEIAGPGFINFFLSPEFLAELLLEILEKGDDRYGRSKLGK 115 Query: 120 GTKVNIEFVSANPTGPMHVGHCRCAVVGDTLASLMAFSGYEVTREYYINDAGAQINTLAL 179 G KV IE+ SANPTGP+H+GH R A++GD+LA ++ F GY+VTRE Y+ND G QI LAL Sbjct: 116 GKKVVIEYSSANPTGPLHIGHLRNAIIGDSLARILEFLGYDVTRENYVNDWGTQIGMLAL 175 Query: 180 SVFWRYQQALYNNDSDLPEGYYPGVYLKHVGKELADKYS-SELLNFPEEKWLPIVKDYS- 237 S R ++AL Y G Y + K+L + E E + L + + Sbjct: 176 SYEKRGREALG---LTPEPDGYLGEYYVKIAKDLEEDPGNDEEEAREEVEKLESGDEEAE 232 Query: 238 -----VQAMMKIIRDDLKALNIQHDIFISEDDFHRGDPSPIRDIIDNLARQGYVYEGILP 292 V ++ I++ L L ++ D++ SE + + ++++L +G +YE Sbjct: 233 LWRKFVDLSLEGIKETLDRLGVKFDVYDSEGESFYNG--KVEKVVEDLEEKGLLYE---- 286 Query: 293 PPKSKTTQKCDMDRKQLLFRSTMVGDDVDRPLLKSDGSYTYFAADLAYFKCKYERGFDNM 352 L + GDD DR L KSDG+Y YF D+AY K+ERGFD + Sbjct: 287 -DDGALVVD--------LLKFKKFGDDKDRVLQKSDGTYLYFTRDIAYHLYKFERGFDKL 337 Query: 353 IYVMGSDHSGYVKRLEAVAAAVSEKKAQINVLLCELVRLYRDGMPIKMSKRAGDFITLRH 412 IYV+G+D G+ K+L+AV + + VLL + V L R G +KMS RAG+ +TL Sbjct: 338 IYVLGADQHGHFKQLKAVLELLGYGPDK-EVLLHQGVGLVRGGEGVKMSTRAGNVVTLDD 396 Query: 413 VVDE----------------------VGSDSVRFMMLWRKNSELLDFDFCKVKEQSKENP 450 ++DE VG D+VR+ L R + FD+ K N Sbjct: 397 LLDEAGERAPEEMEEKEEKNEEIAEVVGIDAVRYADLSRSRDKDYVFDWDKALSFEG-NT 455 Query: 451 VFYVQYAYARCRSIFRQAKDIFPDLDFDLFPRNVIPQESEFDTSELQLIVHLAEYPRVIE 510 YVQYA+AR SI R+A + DL + + E +L+ L E+P V+E Sbjct: 456 APYVQYAHARICSILRKAGEDELDLSTEAD-------ALLTELEERELVKKLLEFPEVLE 508 Query: 511 NATIAQEPYKLAFYLYDLASVFHGHWSHGRENPRLRFVQANNRKLTMMRLQLVHAVASII 570 A EP++LA YLYDLA F+ ++ + A N +L RL LV A ++ Sbjct: 509 EAAEELEPHRLANYLYDLAGSFNSFYNA------CPVLGAENEELRAARLALVKATRQVL 562 Query: 571 NSGLNIIGVESPNEM 585 +GL+++G+E+P M Sbjct: 563 KNGLDLLGIEAPERM 577 >gnl|CDD|185675 cd00671, ArgRS_core, catalytic core domain of arginyl-tRNA synthetases. Arginyl tRNA synthetase (ArgRS) catalytic core domain. This class I enzyme is a monomer which aminoacylates the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. There are at least three subgroups of ArgRS. One type contains both characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding. The second subtype lacks the KMSKS motif; however, it has a lysine N-terminal to the HIGH motif, which serves as the functional counterpart to the second lysine of the KMSKS motif. A third group, which is found primarily in archaea and a few bacteria, lacks both the KMSKS motif and the HIGH loop lysine. Length = 212 Score = 209 bits (534), Expect = 2e-54 Identities = 97/285 (34%), Positives = 139/285 (48%), Gaps = 74/285 (25%) Query: 122 KVNIEFVSANPTGPMHVGHCRCAVVGDTLASLMAFSGYEVTREYYINDAGAQINTLALSV 181 K+ +EFVSANPTGP+HVGH R A++GD+LA ++ F GY+VTREYYIND G QI L LS+ Sbjct: 1 KILVEFVSANPTGPLHVGHLRNAIIGDSLARILEFLGYDVTREYYINDWGRQIGLLILSL 60 Query: 182 FWRYQQALYNNDSDLPEGYYPGVYLKHVGKELADKYSSELLNFPEEKWLPIVKDYSVQAM 241 EKW +V++ Sbjct: 61 ---------------------------------------------EKWRKLVEE-----S 70 Query: 242 MKIIRDDLKALNIQHDIFISEDDFHRGDPSPIRDIIDNLARQGYVYEGILPPPKSKTTQK 301 +K + L+++ D++ E + +++ L G +YE Sbjct: 71 IKADLETYGRLDVRFDVWFGESSYLGLMG----KVVELLEELGLLYE------------- 113 Query: 302 CDMDRKQLLFRSTMVGDDVDRPLLKSDGSYTYFAADLAYFKCKYERGFDNMIYVMGSDHS 361 + L T GDD DR L++SDG+YTYF D+AY K+ERG D +IYV+G+DH Sbjct: 114 ---EDGALWLDLTEFGDDKDRVLVRSDGTYTYFTRDIAYHLDKFERGADKIIYVVGADHH 170 Query: 362 GYVKRLEAVAAAVSEKKAQ-INVLLCELVRLYRDGMPIKMSKRAG 405 G+ KRL A + +A+ + LL +V L ++G KMS RAG Sbjct: 171 GHFKRLFAALELLGYDEAKKLEHLLYGMVNLPKEG---KMSTRAG 212 >gnl|CDD|144375 pfam00750, tRNA-synt_1d, tRNA synthetases class I (R). Other tRNA synthetase sub-families are too dissimilar to be included. This family includes only arginyl tRNA synthetase. Length = 345 Score = 196 bits (499), Expect = 2e-50 Identities = 106/369 (28%), Positives = 163/369 (44%), Gaps = 54/369 (14%) Query: 101 ILSSIVVSGIEYGRNLIGKGTKVNIEFVSANPTGPMHVGHCRCAVVGDTLASLMAFSGYE 160 I++ I+ G + + + KV +EF S NP P+HVGH R ++GD L+ L+ F GY+ Sbjct: 1 IVTKILAQGGL--GSALLENKKVVVEFSSPNPAKPIHVGHLRSTIIGDALSRLLEFLGYD 58 Query: 161 VTREYYINDAGAQINTLALSVFWRYQQALYNND--SDLPEGYYPGVYLKHVGKELADKYS 218 V RE Y+ D G Q L S+ ++ L DL +G Y G+ ++ +E+ K + Sbjct: 59 VVRENYVGDWGTQFGMLIASLEAAAKEELTVPMPIQDLEDG-YRGIKKDYIAEEIFAKEA 117 Query: 219 SELLNFPEEKWLPIVKDYSVQAMMKIIRDDLKALNIQHDIFISEDDFHRGDPSPIRDIID 278 + + ++ V + I+ L + D+ + E + D + Sbjct: 118 RNAVVLLQSG-DEEFREMWVLLIFDHIKQSLNKIYDDFDVTLHEGESVYKGRMN--DAVK 174 Query: 279 NLARQGYVYEGILPPPKSKTTQKCDMDRKQLLFRSTMVGDDVDRPLLKSDGSYTYFAADL 338 +L G VYE + L T GDD DR ++KSDG Y DL Sbjct: 175 DLKDNGLVYE----------------NDGALWLFLTEFGDDKDRVVIKSDGGALYITTDL 218 Query: 339 AYFKCKYE-RGFDNMIYVMGSDHSGYVKRLEAVAAAVSEKKAQINVL-LCELVRLYRDGM 396 AY K + E RGFD +IYV+G+D G+++RL A AAA+ + VL + V L +DG Sbjct: 219 AYAKERLEQRGFDLIIYVLGADQHGHIQRLFAAAAALGYDPESVEVLHIGFGVVLGKDGK 278 Query: 397 PIKMSKRAGDFITLRHVVDE--------------------------VGSDSVRFMMLWRK 430 MS RAG+ +TL ++DE +G D+ R+ L Sbjct: 279 R--MSTRAGNVVTLDDLLDEALERAMDIKEKNRDLTADELEAVATAIGVDAARYADLSSN 336 Query: 431 NSELLDFDF 439 FD Sbjct: 337 RDTDYIFDL 345 >gnl|CDD|36409 KOG1195, KOG1195, KOG1195, Arginyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]. Length = 567 Score = 130 bits (329), Expect = 9e-31 Identities = 124/552 (22%), Positives = 215/552 (38%), Gaps = 106/552 (19%) Query: 84 AGKGFINLYLSPSYLRK-ILSSIVVSGIEYGRNLIGKGTKVNIEFVSANPTGPMHVGHCR 142 A F+ +L+ L K +L I +YG+N +G G K+ +EF S N P HVGH R Sbjct: 72 ASGPFVQFFLNRRRLIKSVLPIIEEQREKYGKNELGSGKKIVVEFSSPNIAKPFHVGHLR 131 Query: 143 CAVVGDTLASLMAFSGYEVTREYYINDAGAQINTLALSVFWRYQQALYNNDSDL---PEG 199 ++G+ LA+L G+EVTR Y+ D G Q LAL LY ++ +L P Sbjct: 132 STIIGNFLANLHEALGWEVTRVNYLGDWGKQFGLLALGF------QLYGDEEELQLNPIK 185 Query: 200 YYPGVYLKHVGKELADKYS---------SELLNFPEE---KWLPIVKDYSVQAMMKIIRD 247 + VY+K + K+ L + EE W +D S++ ++K Sbjct: 186 HLFDVYVK-INKDAEKDPDTAEEAREFFKRLEDGDEEHLKLWQRF-RDLSIEKLIKT--- 240 Query: 248 DLKALNIQHDIFISEDDFHRGDPSPIRDIIDNLARQGYVYEGILPPPKSKTTQKCDMDRK 307 LN++ D + E +++ +D L E Sbjct: 241 -YNRLNVKFDEYSGESQVSN---EKMQEALDLLRSANLTEE----------------IDG 280 Query: 308 QLLFRSTMVGDDVDR-PLLKSDGSYTYFAADLAYFKCKYER-GFDNMIYVMGSDHSGYVK 365 ++ + + + + KSDG+ Y D+A + E+ FD +IYV+ S + Sbjct: 281 TIVIDLSKIDKKAGKAVVQKSDGTTLYLTRDIAAALDRLEKYSFDRLIYVVDSQQKDHFC 340 Query: 366 RLEAVAAAVSEKKAQINVLLCELVRLYRDGMPIKMSKRAGDFITLRHVVDE--------- 416 +L + + A+ + V G MS R G + L +++E Sbjct: 341 QLFEILKKMGFDWAK----KLQHVNF---GRVQGMSTRKGKVVFLDDILEEAREQMLEVM 393 Query: 417 -------------------VGSDSVRFMMLWRKNSELLDFDFCKVKEQSKENPVFYVQYA 457 +G +V + +F + +V + + Y+QY Sbjct: 394 ASNKTKPVQMANPDEVADRLGLSAVIVQDFKGRRISNYEFSWNRVL-SFEGDTGPYLQYT 452 Query: 458 YARCRSIFRQAKDIFPDL----DFDLFPRNVIPQESEFDTSELQLIVHLAEYPRVIENAT 513 ++R RS+ R+ D+ D DF L L L+ L ++P V+E + Sbjct: 453 HSRLRSLERKFSDVTLDDLDEIDFSLLTEPDA----------LLLVRLLLQFPEVVEKSM 502 Query: 514 IAQEPYKLAFYLYDLASVFHGHWSHGRENPRLRFVQANNRKLTMMRLQLVHAVASIINSG 573 EP L YL+ LA + V+ + ++ + RL L AV ++N+G Sbjct: 503 EQLEPCTLVTYLFKLAHAVSSAYKILW-------VKDSPMEIALARLLLFSAVRQVLNNG 555 Query: 574 LNIIGVESPNEM 585 + ++G+ + M Sbjct: 556 MRLLGITPVDRM 567 >gnl|CDD|39627 KOG4426, KOG4426, KOG4426, Arginyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]. Length = 656 Score = 129 bits (326), Expect = 2e-30 Identities = 144/595 (24%), Positives = 251/595 (42%), Gaps = 98/595 (16%) Query: 43 GHLSTNAAMILSRPL-----GLDPLTIAELIVARIKIDPDVDSVFIAGKGFINLYLSPSY 97 G N AM LS L P +A+ + + V+ IAG GFIN++LS Y Sbjct: 108 GDYQCNNAMGLSSKLKGKGINKRPRDVAQELQKHLPTSEMVEKCEIAGPGFINVFLSKDY 167 Query: 98 LRKILSSIVVSGIEYGRNLIGKGTKVNIEFVSANPTGPMHVGHCRCAVVGDTLASLMAFS 157 + K +S+++V+G++ L K +V ++F S N MHVGH R ++GD+L L+ FS Sbjct: 168 MSKQISNLLVNGVKLPT-LSVK--RVLVDFSSPNIAKEMHVGHLRSTIIGDSLCRLLEFS 224 Query: 158 GYEVTREYYINDAGAQINTLALSVFWRYQQALYNND--SDLPEGYYPGVYLKHVGKELAD 215 G +V R ++ D G Q L +F ++ L + DL Y KE Sbjct: 225 GVDVLRRNHVGDWGTQFGMLIAHLFDKFPDYLSVSPPIGDLQVFY----------KESKK 274 Query: 216 KYSSELLNFPEEKWLPIVK-----DYSVQAMMKIIRDDLKALNIQH---DIFISE--DDF 265 ++ + F + + +V+ +A I K + DI + E + F Sbjct: 275 RFDED-EEFKKRAYQAVVRLQGGDPDIRKAWALICDVSRKEFQKVYNRLDISLKERGESF 333 Query: 266 HRGDPSPIRDIIDNLARQGYVYEGILPPPKSKTTQKCDMDRKQLLFRSTMVGDDVDRPLL 325 ++ + ++++ L +G V E D ++++F G D+ ++ Sbjct: 334 YQ---DRMAEVVEELKSKGLVEED---------------DGRRIMF---PEGCDIPLTVV 372 Query: 326 KSDGSYTYFAADLAYFKCK-YERGFDNMIYVMGSDHSGYVKRLEAVA---AAVSEKKAQI 381 KSDG +TY +DLA K + E D +IYV+ S S + + A + ++ Sbjct: 373 KSDGGFTYDTSDLAALKYRLNEEKADWIIYVVDSGQSQHFNTIFKAARKAGWLDPTYPRV 432 Query: 382 NVLLCELVRLYRDGMPIKMSKRAGDFITLRHVVDE------------------------- 416 + LV L D K R+G+ + L ++DE Sbjct: 433 EHVGFGLV-LGEDKK--KFKTRSGETVRLLDLLDEGKKRSKEKLIERGRDKVLTPEELDA 489 Query: 417 ----VGSDSVRFMMLWRKNSELLD--FDFCKVKEQSKENPVFYVQYAYARCRSIFRQAKD 470 V +++ L ++ + D F F K+ E + N Y+ YAY R SI R++ Sbjct: 490 AQEAVAYGCIKYADL--SHNRITDYIFSFDKMLE-DRGNTAVYLLYAYTRICSIARKSGK 546 Query: 471 IFPDLDFDLFPRNVIPQESEFDTSELQLIVHLAEYPRVIENATIAQEPYKLAFYLYDLAS 530 DL +L I + E E +L HL ++ ++E A + + L YLY+LA+ Sbjct: 547 DNVDLIKELKKTGKIALDHE---KEWKLGKHLLKFAEIVEKALDSLFLHVLCDYLYELAT 603 Query: 531 VFHGHWSHGRENPRLRFVQANNRKLTMMRLQLVHAVASIINSGLNIIGVESPNEM 585 +F + + + + + M RL L A A+++ +I+G++ +M Sbjct: 604 LFTEFYDSCYVIEKNK--EGEIPFVNMSRLLLCEATAAVMRKCFHILGIKPVYKM 656 >gnl|CDD|153410 cd07956, Anticodon_Ia_Arg, Anticodon-binding domain of arginyl tRNA synthetases. This domain is found in arginyl tRNA synthetases (ArgRS), which belong to the class Ia aminoacyl tRNA synthetases. It lies C-terminal to the catalytic core domain, and recognizes and specifically binds to the tRNA anticodon. ArgRS catalyzes the transfer of arginine to the 3'-end of its tRNA. Length = 156 Score = 115 bits (290), Expect = 4e-26 Identities = 56/175 (32%), Positives = 91/175 (52%), Gaps = 23/175 (13%) Query: 415 DEVGSDSVRFMMLWRKNSELLDFDFCKVKEQSKE-NPVFYVQYAYARCRSIFRQAKDIFP 473 +EVG +V++ L K + FD+ ++ S E + Y+QYA+AR SI R+A + Sbjct: 1 EEVGVGAVKYQDLSNKRIKDYTFDWERM--LSFEGDTGPYLQYAHARLCSILRKAGETIE 58 Query: 474 ---DLDFDLFPRNVIPQESEFDTSELQLIVHLAEYPRVIENATIAQEPYKLAFYLYDLAS 530 D D L +P+ E D LI+ LA++P V++NA EP+ +A YL+DLA Sbjct: 59 AEADADLSL-----LPEPDERD-----LILLLAKFPEVVKNAAETLEPHTIATYLFDLAH 108 Query: 531 VFHGHWSHGRENPRLRFVQANNRKLTMMRLQLVHAVASIINSGLNIIGVESPNEM 585 F ++ + A +L RL LV A ++ +GL+++G+E+P M Sbjct: 109 AFSKFYNA------CPVLGAEE-ELRNARLALVAAARQVLANGLDLLGIEAPERM 156 >gnl|CDD|147737 pfam05746, DALR_1, DALR anticodon binding domain. This all alpha helical domain is the anticodon binding domain in Arginyl and glycyl tRNA synthetase. This domain is known as the DALR domain after characteristic conserved amino acids. Length = 117 Score = 106 bits (268), Expect = 1e-23 Identities = 45/132 (34%), Positives = 74/132 (56%), Gaps = 15/132 (11%) Query: 454 VQYAYARCRSIFRQAKDIFPDLDFDLFPRNVIPQESEFDTSELQLIVHLAEYPRVIENAT 513 +QYA+AR SI R+A ++ +LD I + E +L+ L ++P V+E A Sbjct: 1 LQYAHARICSILRKAGELGINLD--------IDALLLLEEEEKELLKALLQFPEVVEEAA 52 Query: 514 IAQEPYKLAFYLYDLASVFHGHWSHGRENPRLRFVQANNRKLTMMRLQLVHAVASIINSG 573 EP++LA YLYDLAS FH +++ R V + + RL L+ AV ++ +G Sbjct: 53 EELEPHRLANYLYDLASAFHSFYNNCR-------VLDEDDEERNARLALLKAVRQVLKNG 105 Query: 574 LNIIGVESPNEM 585 L+++G+E+P +M Sbjct: 106 LDLLGIEAPEKM 117 >gnl|CDD|146238 pfam03485, Arg_tRNA_synt_N, Arginyl tRNA synthetase N terminal domain. This domain is found at the amino terminus of Arginyl tRNA synthetase, also called additional domain 1 (Add-1). It is about 140 residues long and it has been suggested that this domain will be involved in tRNA recognition. Length = 84 Score = 78.4 bits (194), Expect = 5e-15 Identities = 27/87 (31%), Positives = 40/87 (45%), Gaps = 5/87 (5%) Query: 7 FSSRLKNYLKEIDCKIKVEKKILDRIVIERPRDCAHGHLSTNAAMILSRPLGLDPLTIAE 66 + L + VIE P+D G +TN AM+L++ L +P IAE Sbjct: 3 LKKAIAAALAKAG-----LDLEEIDPVIETPKDPEFGDYATNVAMLLAKKLKKNPREIAE 57 Query: 67 LIVARIKIDPDVDSVFIAGKGFINLYL 93 I ++ ++ V IAG GFIN +L Sbjct: 58 EIAEKLPKSDLIEKVEIAGPGFINFFL 84 >gnl|CDD|173901 cd00802, class_I_aaRS_core, catalytic core domain of class I amino acyl-tRNA synthetase. Class I amino acyl-tRNA synthetase (aaRS) catalytic core domain. These enzymes are mostly monomers which aminoacylate the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding. Length = 143 Score = 41.7 bits (98), Expect = 5e-04 Identities = 20/54 (37%), Positives = 24/54 (44%) Query: 125 IEFVSANPTGPMHVGHCRCAVVGDTLASLMAFSGYEVTREYYINDAGAQINTLA 178 F P G +H+GH R V D LA GY+V I+DAG I A Sbjct: 1 TTFSGITPNGYLHIGHLRTIVTFDFLAQAYRKLGYKVRCIALIDDAGGLIGDPA 54 >gnl|CDD|30492 COG0143, MetG, Methionyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]. Length = 558 Score = 40.6 bits (95), Expect = 0.001 Identities = 36/164 (21%), Positives = 50/164 (30%), Gaps = 63/164 (38%) Query: 132 PTGPMHVGHCRCAVVGDTLASLMAFSGYEV-----TREYYINDAGAQINTLALSVFWRYQ 186 P GP H+GH + D A + GYEV T E+ G +I A Sbjct: 16 PNGPPHLGHLYTYLAADVYARYLRLRGYEVFFLTGTDEH-----GTKIELKAEK------ 64 Query: 187 QALYNNDSDLPEGYYPGVYLKHVGKELADKYSSELLNFPEEKWLPIVKDYSVQAMMKIIR 246 EG P +EL DK + + Sbjct: 65 -----------EGITP--------QELVDKNH------------------------EEFK 81 Query: 247 DDLKALNIQHDIFIS-EDDFHRGDPSPIRDIIDNLARQGYVYEG 289 + KALNI D FI H+ +++ L G +Y Sbjct: 82 ELFKALNISFDNFIRTTSPEHKEL---VQEFFLKLYENGDIYLR 122 Score = 30.2 bits (68), Expect = 1.6 Identities = 13/41 (31%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Query: 399 KMSKRAGDFITLRHVVDEVGSDSVRFMMLWRKNSELLDFDF 439 KMSK G+ + ++++ G D++R+ + R+ E D DF Sbjct: 333 KMSKSRGNVVDPDELLEQYGVDALRYYLA-RELPEGSDGDF 372 >gnl|CDD|173907 cd00814, MetRS_core, catalytic core domain of methioninyl-tRNA synthetases. Methionine tRNA synthetase (MetRS) catalytic core domain. This class I enzyme aminoacylates the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. MetRS, which consists of the core domain and an anti-codon binding domain, functions as a monomer. However, in some species the anti-codon binding domain is followed by an EMAP domain. In this case, MetRS functions as a homodimer. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding. As a result of a deletion event, MetRS has a significantly shorter core domain insertion than IleRS, ValRS, and LeuR. Consequently, the MetRS insertion lacks the editing function. Length = 319 Score = 38.7 bits (91), Expect = 0.004 Identities = 39/164 (23%), Positives = 52/164 (31%), Gaps = 63/164 (38%) Query: 132 PTGPMHVGHCRCAVVGDTLASLMAFSGYEV-----TREYYINDAGAQINTLALSVFWRYQ 186 G H+GH V+ D A GY+V T E+ G +I A Sbjct: 11 VNGVPHLGHLYGTVLADVFARYQRLRGYDVLFVTGTDEH-----GTKIEQKAEE------ 59 Query: 187 QALYNNDSDLPEGYYPGVYLKHVGKELADKYSSELLNFPEEKWLPIVKDYSVQAMMKIIR 246 EG P +EL DKY +I + Sbjct: 60 -----------EGVTP--------QELCDKYH------------------------EIFK 76 Query: 247 DDLKALNIQHDIFIS-EDDFHRGDPSPIRDIIDNLARQGYVYEG 289 D K LNI D FI H+ +++ L GY+YEG Sbjct: 77 DLFKWLNISFDYFIRTTSPRHKE---IVQEFFKKLYENGYIYEG 117 >gnl|CDD|30564 COG0215, CysS, Cysteinyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]. Length = 464 Score = 36.7 bits (85), Expect = 0.016 Identities = 24/110 (21%), Positives = 44/110 (40%), Gaps = 14/110 (12%) Query: 399 KMSKRAGDFITLRHVVDEVGSDSVRFMML---WRKNSELLDFDFCKVKEQSKENPVFYVQ 455 KMSK G+FIT+R ++ + + +R +L +R DF + + + + + Sbjct: 268 KMSKSLGNFITVRDLLKKYDPEVLRLFLLSSHYRS-----PLDFSEELLEEAKKALERLY 322 Query: 456 YAYARCRSIFRQAKDIFPDLDFDLFPRNVIPQ-ESEFDTSE-LQLIVHLA 503 A R R D F + +F+T + L ++ LA Sbjct: 323 NALRR----LRDLAGDAELADLKEFEARFREALDDDFNTPKALAVLFELA 368 Score = 33.3 bits (76), Expect = 0.18 Identities = 22/78 (28%), Positives = 30/78 (38%), Gaps = 10/78 (12%) Query: 137 HVGHCRCAVVGDTLASLMAFSGYEVTREYYIND------AGAQINTLALSVFWRYQQALY 190 H+GH R VV D L + + GY+VT I D A+ L++ A + Sbjct: 37 HIGHARTYVVFDVLRRYLRYLGYKVTYVRNITDIDDKIINRAREEGLSIREVAERYIAAF 96 Query: 191 NNDSD----LPEGYYPGV 204 D D LP P Sbjct: 97 FEDMDALNVLPPDIEPRA 114 >gnl|CDD|30409 COG0060, IleS, Isoleucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]. Length = 933 Score = 36.3 bits (84), Expect = 0.023 Identities = 31/122 (25%), Positives = 51/122 (41%), Gaps = 6/122 (4%) Query: 328 DGSYTYFAADLAYFKCKYERGFDNMIYVMGSD-HSGYVKRLEAVAAAVSEKKAQINVLLC 386 D T +A K+ F + Y+ GSD G+ + A+ + NVL Sbjct: 534 DSGSTPYAVLHPRENLKFPALFADF-YLEGSDQTRGWFYSSLLTSTALFGRAPYKNVLTH 592 Query: 387 ELVRLYRDGMPIKMSKRAGDFITLRHVVDEVGSDSVRFMMLWRKNSELLDFDFCKVKEQS 446 V D KMSK G+ + + V+D+ G+D +R + E L F ++ +Q Sbjct: 593 GFVL---DEKGRKMSKSLGNVVDPQDVIDKYGADILRLWVASSDYWEDLRFSD-EILKQV 648 Query: 447 KE 448 +E Sbjct: 649 RE 650 >gnl|CDD|143905 pfam00133, tRNA-synt_1, tRNA synthetases class I (I, L, M and V). Other tRNA synthetase sub-families are too dissimilar to be included. Length = 606 Score = 36.2 bits (84), Expect = 0.025 Identities = 26/85 (30%), Positives = 44/85 (51%), Gaps = 4/85 (4%) Query: 344 KYERGFDNMIYVMGSD-HSGYVKRLEAVAAAVSEKKAQINVLLCELVRLYRDGMPIKMSK 402 +++R F + + GSD G+ R+ + A++ NVL+ LVR D KMSK Sbjct: 514 EFKRFFPADMLLEGSDQTRGWFYRMIVLGTALTGSAPYKNVLVHGLVR---DEQGRKMSK 570 Query: 403 RAGDFITLRHVVDEVGSDSVRFMML 427 G+ I V+D+ G+D++R + Sbjct: 571 SLGNVIDPLDVIDKYGADALRLWLA 595 >gnl|CDD|173899 cd00672, CysRS_core, catalytic core domain of cysteinyl tRNA synthetase. Cysteinyl tRNA synthetase (CysRS) catalytic core domain. This class I enzyme is a monomer which aminoacylates the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding. Length = 213 Score = 35.2 bits (82), Expect = 0.045 Identities = 14/39 (35%), Positives = 21/39 (53%) Query: 399 KMSKRAGDFITLRHVVDEVGSDSVRFMMLWRKNSELLDF 437 KMSK G+FIT+R + + + +R +L LDF Sbjct: 174 KMSKSLGNFITVRDALKKYDPEVLRLALLSSHYRSPLDF 212 Score = 31.0 bits (71), Expect = 0.90 Identities = 30/106 (28%), Positives = 37/106 (34%), Gaps = 22/106 (20%) Query: 121 TKVNIEFVSANPT-------GP-----MHVGHCRCAVVGDTLASLMAFSGYEVTREYYIN 168 T+ EFV NP GP H+GH R VV D L + GY+V I Sbjct: 7 TRQKEEFVPLNPGLVTMYVCGPTVYDYAHIGHARTYVVFDVLRRYLEDLGYKVRYVQNIT 66 Query: 169 DAGAQINTLA--LSVFW----RYQQALYNNDSD----LPEGYYPGV 204 D +I A + W Y + D LP P V Sbjct: 67 DIDDKIIKRAREEGLSWKEVADYYTKEFFEDMKALNVLPPDVVPRV 112 >gnl|CDD|185677 cd00817, ValRS_core, catalytic core domain of valyl-tRNA synthetases. Valine amino-acyl tRNA synthetase (ValRS) catalytic core domain. This enzyme is a monomer which aminoacylates the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding. ValRS has an insertion in the core domain, which is subject to both deletions and rearrangements. This editing region hydrolyzes mischarged cognate tRNAs and thus prevents the incorporation of chemically similar amino acids. Length = 382 Score = 35.3 bits (82), Expect = 0.046 Identities = 18/43 (41%), Positives = 23/43 (53%), Gaps = 3/43 (6%) Query: 382 NVLLCELVRLYRDGMPIKMSKRAGDFITLRHVVDEVGSDSVRF 424 V L LVR D KMSK G+ I V+D G+D++RF Sbjct: 329 EVYLHGLVR---DEDGRKMSKSLGNVIDPLDVIDGYGADALRF 368 Score = 28.0 bits (63), Expect = 6.7 Identities = 11/31 (35%), Positives = 15/31 (48%) Query: 131 NPTGPMHVGHCRCAVVGDTLASLMAFSGYEV 161 N TG +H+GH + D +A GY V Sbjct: 11 NVTGSLHMGHALNNTIQDIIARYKRMKGYNV 41 >gnl|CDD|173909 cd00818, IleRS_core, catalytic core domain of isoleucyl-tRNA synthetases. Isoleucine amino-acyl tRNA synthetases (IleRS) catalytic core domain . This class I enzyme is a monomer which aminoacylates the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding. IleRS has an insertion in the core domain, which is subject to both deletions and rearrangements. This editing region hydrolyzes mischarged cognate tRNAs and thus prevents the incorporation of chemically similar amino acids. Length = 338 Score = 35.3 bits (82), Expect = 0.047 Identities = 24/76 (31%), Positives = 40/76 (52%), Gaps = 4/76 (5%) Query: 354 YVMGSD-HSGYVKRLEAVAAAVSEKKAQINVLLCELVRLYRDGMPIKMSKRAGDFITLRH 412 + GSD G+ L ++ A+ K NV++ V L DG KMSK G+++ + Sbjct: 256 ILEGSDQTRGWFYSLLLLSTALFGKAPYKNVIVHGFV-LDEDGR--KMSKSLGNYVDPQE 312 Query: 413 VVDEVGSDSVRFMMLW 428 VVD+ G+D++R + Sbjct: 313 VVDKYGADALRLWVAS 328 >gnl|CDD|173906 cd00812, LeuRS_core, catalytic core domain of leucyl-tRNA synthetases. Leucyl tRNA synthetase (LeuRS) catalytic core domain. This class I enzyme is a monomer which aminoacylates the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding. In Aquifex aeolicus, the gene encoding LeuRS is split in two, just before the KMSKS motif. Consequently, LeuRS is a heterodimer, which likely superimposes with the LeuRS monomer found in most other organisms. LeuRS has an insertion in the core domain, which is subject to both deletions and rearrangements and thus differs between prokaryotic LeuRS and archaeal/eukaryotic LeuRS. This editing region hydrolyzes mischarged cognate tRNAs and thus prevents the incorporation of chemically similar amino acids. Length = 314 Score = 34.5 bits (80), Expect = 0.075 Identities = 13/30 (43%), Positives = 17/30 (56%) Query: 132 PTGPMHVGHCRCAVVGDTLASLMAFSGYEV 161 P+G +HVGH R +GD +A GY V Sbjct: 11 PSGALHVGHVRTYTIGDIIARYKRMQGYNV 40 Score = 34.5 bits (80), Expect = 0.089 Identities = 10/29 (34%), Positives = 17/29 (58%) Query: 399 KMSKRAGDFITLRHVVDEVGSDSVRFMML 427 KMSK G+ +T + + G+D+ R +L Sbjct: 275 KMSKSKGNVVTPDEAIKKYGADAARLYIL 303 >gnl|CDD|35658 KOG0437, KOG0437, KOG0437, Leucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]. Length = 1080 Score = 33.8 bits (77), Expect = 0.12 Identities = 11/26 (42%), Positives = 17/26 (65%) Query: 399 KMSKRAGDFITLRHVVDEVGSDSVRF 424 KMSK G+F+TL +++ G+D R Sbjct: 710 KMSKSTGNFMTLEQAIEKFGADGTRL 735 >gnl|CDD|35656 KOG0435, KOG0435, KOG0435, Leucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]. Length = 876 Score = 33.8 bits (77), Expect = 0.12 Identities = 12/30 (40%), Positives = 16/30 (53%) Query: 132 PTGPMHVGHCRCAVVGDTLASLMAFSGYEV 161 P+G +H+GH R + D LA GY V Sbjct: 68 PSGALHIGHVRVYTISDILARFYRMKGYNV 97 >gnl|CDD|30871 COG0525, ValS, Valyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]. Length = 877 Score = 33.7 bits (77), Expect = 0.14 Identities = 15/36 (41%), Positives = 22/36 (61%) Query: 391 LYRDGMPIKMSKRAGDFITLRHVVDEVGSDSVRFMM 426 L RD KMSK G+ I V+D+ G+D++RF + Sbjct: 517 LVRDEQGRKMSKSKGNVIDPLDVIDKYGADALRFTL 552 >gnl|CDD|35655 KOG0434, KOG0434, KOG0434, Isoleucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]. Length = 1070 Score = 33.4 bits (76), Expect = 0.16 Identities = 29/105 (27%), Positives = 53/105 (50%), Gaps = 7/105 (6%) Query: 342 KCKYERGFDNMIYVMGSDHS-GYVKRLEAVAAAVSEKKAQINVLLCELVRLYRDGMPIKM 400 K ++E F G D + G+ L ++ A+ K NV++ LV L DG KM Sbjct: 546 KEEFEENFPADFIAEGLDQTRGWFYTLLVLSTALFGKPPFKNVIVNGLV-LAEDGK--KM 602 Query: 401 SKRAGDFITLRHVVDEVGSDSVRFMMLWRKNSELLDFDFCKVKEQ 445 SKR ++ ++++ G+D++R ++ NS ++ + K KE+ Sbjct: 603 SKRLKNYPDPSLIINKYGADALRLYLI---NSPVVRAENLKFKEE 644 >gnl|CDD|173900 cd00674, LysRS_core_class_I, catalytic core domain of class I lysyl tRNA synthetase. Class I lysyl tRNA synthetase (LysRS) catalytic core domain. This class I enzyme is a monomer which aminoacylates the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding. The class I LysRS is found only in archaea and some bacteria and has evolved separately from class II LysRS, as the two do not share structural or sequence similarity. Length = 353 Score = 33.1 bits (76), Expect = 0.21 Identities = 13/42 (30%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Query: 398 IKMSKRAGDFITLRHVVDEVGSDSVRFMMLWRKNSEL-LDFD 438 KMS G+ IT ++ + +R++ RKN E + FD Sbjct: 274 GKMSSSKGNVITPSDWLEVAPPEVLRYLYARRKNPEKHIGFD 315 >gnl|CDD|30841 COG0495, LeuS, Leucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]. Length = 814 Score = 32.9 bits (75), Expect = 0.24 Identities = 13/30 (43%), Positives = 17/30 (56%) Query: 132 PTGPMHVGHCRCAVVGDTLASLMAFSGYEV 161 P+G +HVGH R +GD +A GY V Sbjct: 45 PSGALHVGHVRNYTIGDVIARYKRMQGYNV 74 Score = 31.8 bits (72), Expect = 0.56 Identities = 10/29 (34%), Positives = 18/29 (62%) Query: 399 KMSKRAGDFITLRHVVDEVGSDSVRFMML 427 KMSK G+ + V++ G+D+VR ++ Sbjct: 579 KMSKSKGNVVDPEEAVEKYGADTVRLYIM 607 >gnl|CDD|31574 COG1384, LysS, Lysyl-tRNA synthetase (class I) [Translation, ribosomal structure and biogenesis]. Length = 521 Score = 32.5 bits (74), Expect = 0.29 Identities = 12/43 (27%), Positives = 23/43 (53%) Query: 397 PIKMSKRAGDFITLRHVVDEVGSDSVRFMMLWRKNSELLDFDF 439 KMS G+ I+L ++ + +R+++ K + +DFDF Sbjct: 275 GGKMSSSKGNVISLSDWLEVAPPEVLRYLIARTKPNRHIDFDF 317 >gnl|CDD|185682 cd09287, GluRS_non_core, catalytic core domain of non-discriminating glutamyl-tRNA synthetase. Non-discriminating Glutamyl-tRNA synthetase (GluRS) cataytic core domain. These enzymes attach Glu to the appropriate tRNA. Like other class I tRNA synthetases, they aminoacylate the 2'-OH of the nucleotide at the 3' end of the tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding. These enzymes function as monomers. Archaea and most bacteria lack GlnRS. In these organisms, the "non-discriminating" form of GluRS aminoacylates both tRNA(Glu) and tRNA(Gln) with Glu, which is converted to Gln when appropriate by a transamidation enzyme. Length = 240 Score = 32.3 bits (74), Expect = 0.41 Identities = 10/21 (47%), Positives = 14/21 (66%) Query: 131 NPTGPMHVGHCRCAVVGDTLA 151 NP GP+H+GH R A++ A Sbjct: 9 NPNGPLHLGHARAAILNGEYA 29 >gnl|CDD|37218 KOG2007, KOG2007, KOG2007, Cysteinyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]. Length = 586 Score = 31.5 bits (71), Expect = 0.62 Identities = 21/108 (19%), Positives = 38/108 (35%), Gaps = 14/108 (12%) Query: 399 KMSKRAGDFITLRHVVDEVGSDSVRFMMLWRKNSELLDFDFCKVKEQSKENPVFYVQYAY 458 KMSK +FIT++ + + +R L + LD+ ++ + Sbjct: 305 KMSKSLKNFITIKEALKKYSPRQLRLAFLLHQWRSPLDY---------SDSTMEQALQLE 355 Query: 459 ARCRSIFRQAKDIFPDLDFDLFPRNVIPQESEF--DTSELQLIVHLAE 504 + F K + L + +E+E D + Q VH A Sbjct: 356 KSLNNFFLDVKAL---LRGAKPFEKLSEKEAELLEDFGKTQTAVHAAL 400 >gnl|CDD|110410 pfam01406, tRNA-synt_1e, tRNA synthetases class I (C) catalytic domain. This family includes only cysteinyl tRNA synthetases. Length = 301 Score = 31.5 bits (72), Expect = 0.65 Identities = 11/26 (42%), Positives = 14/26 (53%) Query: 137 HVGHCRCAVVGDTLASLMAFSGYEVT 162 H+GH R AV D L + GY+V Sbjct: 24 HIGHARSAVAFDVLRRYLQALGYDVQ 49 >gnl|CDD|147298 pfam05041, Pecanex_C, Pecanex protein (C-terminus). This family consists of C terminal region of the pecanex protein homologues. The pecanex protein is a maternal-effect neurogenic gene found in Drosophila. Length = 232 Score = 31.0 bits (70), Expect = 0.92 Identities = 15/37 (40%), Positives = 22/37 (59%), Gaps = 4/37 (10%) Query: 409 TLRHVVDEVGSDSVRFMMLWRKNSELLDFDFCKVKEQ 445 TLRHVVD+ G+D + +ML R+ L F K+ + Sbjct: 135 TLRHVVDD-GTDEYKIIMLTRR---HLSFKVIKLNRE 167 >gnl|CDD|37033 KOG1822, KOG1822, KOG1822, Uncharacterized conserved protein [Function unknown]. Length = 2067 Score = 31.1 bits (70), Expect = 0.99 Identities = 26/135 (19%), Positives = 49/135 (36%), Gaps = 13/135 (9%) Query: 154 MAFSGYEVTREYYINDAGAQINTLALSVFWRYQQALYNNDSDLPEGYYPGVYLKHVGKEL 213 M+ + + E + + Q + + RY + +L E L +L Sbjct: 1 MSLASLLLLNETSLVASPEQKRPVFCLEWLRYL------ERNLNE--EQKEDLLVTQLKL 52 Query: 214 ADKYSSELLNFPEEKWLPIVKDYSVQAMMKIIRDDLKALNIQHDIFISEDDFHRGDPSPI 273 + S L N P K SV A+ ++I + + ++ + D G PS Sbjct: 53 EQQLISRLTNGAG---PPTRKLISV-AIARLI-SNGDSFSLYSRLNSCNDFLSDGSPSDP 107 Query: 274 RDIIDNLARQGYVYE 288 + + L+ G +YE Sbjct: 108 QRKLAALSCLGSLYE 122 >gnl|CDD|110451 pfam01450, IlvC, Acetohydroxy acid isomeroreductase, catalytic domain. Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates. This reaction is the second in the synthetic pathway of the essential branched side chain amino acids valine and isoleucine. Length = 146 Score = 30.3 bits (69), Expect = 1.6 Identities = 23/113 (20%), Positives = 40/113 (35%), Gaps = 26/113 (23%) Query: 338 LAYFKC----------KYERGFDNMIYVMGSDHSGYVKRLEAVAAAVSEKKAQINVLLCE 387 +AYF+ YE G M + S + Y L K + +L + Sbjct: 40 IAYFETLHELKLIVDLIYEGGLSGMRDSI-STTAEYGAYLWGPRIITEATKILMKEILKD 98 Query: 388 LVRLYRDGMPIK---MSKRAGD--FITLR-----HVVDEVGSDSVRFMMLWRK 430 + ++G K + AG+ R H +++VG +R +M K Sbjct: 99 I----QNGTFAKEWLLENSAGNPRLNKERKEIREHPIEKVGKK-LRKLMPELK 146 >gnl|CDD|100095 cd05802, GlmM, GlmM is a bacterial phosphoglucosamine mutase (PNGM) that belongs to the alpha-D-phosphohexomutase superfamily. It is required for the interconversion of glucosamine-6-phosphate and glucosamine-1-phosphate in the biosynthetic pathway of UDP-N-acetylglucosamine, an essential precursor to components of the cell envelope. In order to be active, GlmM must be phosphorylated, which can occur via autophosphorylation or by the Ser/Thr kinase StkP. GlmM functions in a classical ping-pong bi-bi mechanism with glucosamine-1,6-diphosphate as an intermediate. Other members of the alpha-D-phosphohexomutase superfamily include phosphoglucosamine mutase (PNGM), phosphoacetylglucosamine mutase (PAGM), the bacterial phosphomannomutase ManB, and the bifunctional phosphomannomutase/phosphoglucomutase (PMM/PGM). Each of these enzymes has four domains with a centrally located active site formed by four loops, one from each domain. All four domains are included in this alignment model.. Length = 434 Score = 30.1 bits (69), Expect = 1.8 Identities = 23/78 (29%), Positives = 30/78 (38%), Gaps = 20/78 (25%) Query: 2 YLFADFSSRLKNYLKEIDCKIKVEKKILD--RIVIERPRDCAHGHLSTNAAMILSRPLGL 59 Y D R +LK K +L +IV+ DCA+G A + LG Sbjct: 145 YRIDDARGRYIEFLKST-----FPKDLLSGLKIVL----DCANGAAYKVAPEVFRE-LG- 193 Query: 60 DPLTIAELIVARIKIDPD 77 AE+IV I PD Sbjct: 194 -----AEVIV--INNAPD 204 >gnl|CDD|133142 cd05475, nucellin_like, Nucellins, plant aspartic proteases specifically expressed in nucellar cells during degradation. Nucellins are important regulators of nucellar cell's progressive degradation after ovule fertilization. This degradation is a characteristic of programmed cell death. Nucellins are plant aspartic proteases specifically expressed in nucellar cells during degradation. The enzyme is characterized by having two aspartic protease catalytic site motifs, the Asp-Thr-Gly-Ser in the N-terminal and Asp-Ser-Gly-Ser in the C-terminal region, and two other regions nearly identical to two regions of plant aspartic proteases. Aspartic proteases are bilobal enzymes, each lobe contributing a catalytic Asp residue, with an extended active site cleft localized between the two lobes of the molecule. One lobe may be evolved from the other through ancient gene-duplication event. Although the three-dimensional structures of the two lobes are very similar, the amino acid sequences are more divergent, except for the conserved catalytic site motif. Length = 273 Score = 30.0 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Query: 309 LLFRSTMVGDDVDRPLLKSDGSYTYFAADLAYFK 342 LLF G + S SYTYF A AYFK Sbjct: 166 LLFNGQPTGGKGLEVVFDSGSSYTYFNAQ-AYFK 198 >gnl|CDD|143812 pfam00022, Actin, Actin. Length = 369 Score = 29.5 bits (67), Expect = 2.7 Identities = 31/128 (24%), Positives = 48/128 (37%), Gaps = 34/128 (26%) Query: 57 LGLDPLTIAELIVARI-KIDPDVDSVFIAGKGFINLYLSPSYLRK-ILSSIVVSGIEYGR 114 +G + I ELI I D D LR +L++IVV+G G Sbjct: 260 IGSESAGIPELIYDSINACDVD--------------------LRPSLLANIVVTG---GT 296 Query: 115 NLI-GKGTKVNIEFVSANPTGP---MH-VGHCRCAVV---GDTLASLMAFSGYEVTREYY 166 L G ++ E P+G + + R G LASL F V+++ Y Sbjct: 297 TLFPGFTERLEKELAQLAPSGVKVKIIAPPNERKYSAWIGGSILASLGTFQQMWVSKQEY 356 Query: 167 INDAGAQI 174 + G+ + Sbjct: 357 -EEHGSSV 363 >gnl|CDD|30358 COG0008, GlnS, Glutamyl- and glutaminyl-tRNA synthetases [Translation, ribosomal structure and biogenesis]. Length = 472 Score = 29.5 bits (66), Expect = 2.8 Identities = 9/21 (42%), Positives = 14/21 (66%) Query: 131 NPTGPMHVGHCRCAVVGDTLA 151 +PTG +H+GH R A++ A Sbjct: 17 SPTGYLHIGHARTALLNYLYA 37 >gnl|CDD|145212 pfam01921, tRNA-synt_1f, tRNA synthetases class I (K). This family includes only lysyl tRNA synthetases from prokaryotes. Length = 355 Score = 29.1 bits (66), Expect = 3.4 Identities = 13/41 (31%), Positives = 21/41 (51%) Query: 399 KMSKRAGDFITLRHVVDEVGSDSVRFMMLWRKNSELLDFDF 439 KMS G+ IT+ ++ +S+RF+M K + DF Sbjct: 278 KMSSSKGNGITIEEWLEYAPPESLRFLMFRVKPKKAKRLDF 318 >gnl|CDD|185674 cd00668, Ile_Leu_Val_MetRS_core, catalytic core domain of isoleucyl, leucyl, valyl and methioninyl tRNA synthetases. Catalytic core domain of isoleucyl, leucyl, valyl and methioninyl tRNA synthetases. These class I enzymes are all monomers. However, in some species, MetRS functions as a homodimer, as a result of an additional C-terminal domain. These enzymes aminoacylate the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding. Enzymes in this subfamily share an insertion in the core domain, which is subject to both deletions and rearrangements. This editing region hydrolyzes mischarged cognate tRNAs and thus prevents the incorporation of chemically similar amino acids. MetRS has a significantly shorter insertion, which lacks the editing function. Length = 312 Score = 28.9 bits (65), Expect = 3.8 Identities = 12/41 (29%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Query: 399 KMSKRAGDFITLRHVVDEVGSDSVRFMMLWRKNSELLDFDF 439 KMSK G+ I VV++ G+D++R+ + D Sbjct: 273 KMSKSKGNVIDPSDVVEKYGADALRYYLT-SLAPYGDDIRL 312 >gnl|CDD|143593 cd07569, DCase, N-carbamyl-D-amino acid amidohydrolase (DCase, class 6 nitrilases). DCase hydrolyses N-carbamyl-D-amino acids to produce D-amino acids. It is an important biocatalyst in the pharmaceutical industry, producing useful D-amino acids for example in the preparation of beta-lactam antibiotics. This subgroup belongs to a larger nitrilase superfamily comprised of nitrile- or amide-hydrolyzing enzymes and amide-condensing enzymes, which depend on a Glu-Lys-Cys catalytic triad. This superfamily has been classified in the literature based on global and structure based sequence analysis into thirteen different enzyme classes (referred to as 1-13), this subgroup corresponds to class 6. Members of this superfamily generally form homomeric complexes, the basic building block of which is a homodimer. Agrobacterium radiobacter DCase forms a tetramer (dimer of dimers). Some DCases may form trimers. Length = 302 Score = 28.8 bits (65), Expect = 4.4 Identities = 13/41 (31%), Positives = 19/41 (46%), Gaps = 7/41 (17%) Query: 459 ARCRSIFRQAKD------IFPDLDF-DLFPRNVIPQESEFD 492 AR ++ +A +FP+L FPR P E+E D Sbjct: 25 ARLIALLEEAASRGAQLVVFPELALTTFFPRWYFPDEAELD 65 >gnl|CDD|185672 cd00418, GlxRS_core, catalytic core domain of glutamyl-tRNA and glutaminyl-tRNA synthetase. Glutamyl-tRNA synthetase(GluRS)/Glutaminyl-tRNA synthetase (GlnRS) cataytic core domain. These enzymes attach Glu or Gln, respectively, to the appropriate tRNA. Like other class I tRNA synthetases, they aminoacylate the 2'-OH of the nucleotide at the 3' end of the tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding. These enzymes function as monomers. Archaea, cellular organelles, and some bacteria lack GlnRS. In these cases, the "non-discriminating" form of GluRS aminoacylates both tRNA(Glu) and tRNA(Gln) with Glu, which is converted to Gln when appropriate by a transamidation enzyme. The discriminating form of GluRS differs from GlnRS and the non-discriminating form of GluRS in their C-terminal anti-codon binding domains. Length = 230 Score = 28.6 bits (64), Expect = 5.4 Identities = 9/21 (42%), Positives = 13/21 (61%) Query: 131 NPTGPMHVGHCRCAVVGDTLA 151 +PTG +H+GH R A+ A Sbjct: 9 SPTGYLHIGHARTALFNFAFA 29 >gnl|CDD|35653 KOG0432, KOG0432, KOG0432, Valyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]. Length = 995 Score = 28.3 bits (63), Expect = 6.7 Identities = 12/31 (38%), Positives = 16/31 (51%) Query: 131 NPTGPMHVGHCRCAVVGDTLASLMAFSGYEV 161 N TG +H+GH + D LA GY+V Sbjct: 85 NVTGSLHIGHALTVAIQDALARYNRMHGYQV 115 >gnl|CDD|39606 KOG4405, KOG4405, KOG4405, GDP dissociation inhibitor [Signal transduction mechanisms, Intracellular trafficking, secretion, and vesicular transport]. Length = 547 Score = 28.1 bits (62), Expect = 8.2 Identities = 14/41 (34%), Positives = 21/41 (51%), Gaps = 5/41 (12%) Query: 457 AYARCRSIFRQAKDIFPDLDFDLFPRNVIPQESEFDTSELQ 497 A + R++F++ IFP DF PR P+E D + Q Sbjct: 484 AVEQARTLFQK---IFPSEDF--LPRAPNPEEIITDGEDDQ 519 >gnl|CDD|177026 CHL00094, dnaK, heat shock protein 70. Length = 621 Score = 27.8 bits (62), Expect = 8.5 Identities = 8/18 (44%), Positives = 14/18 (77%) Query: 121 TKVNIEFVSANPTGPMHV 138 T++N+ F++A TGP H+ Sbjct: 274 TEINLPFITATQTGPKHI 291 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.322 0.139 0.412 Gapped Lambda K H 0.267 0.0744 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 7,342,264 Number of extensions: 407760 Number of successful extensions: 1041 Number of sequences better than 10.0: 1 Number of HSP's gapped: 1016 Number of HSP's successfully gapped: 62 Length of query: 586 Length of database: 6,263,737 Length adjustment: 99 Effective length of query: 487 Effective length of database: 4,124,446 Effective search space: 2008605202 Effective search space used: 2008605202 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 60 (26.9 bits)