HHsearch alignment for GI: 254780286 and conserved domain: COG3437

>COG3437 Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription / Signal transduction mechanisms].
Probab=92.61  E-value=0.15  Score=31.10  Aligned_cols=33  Identities=39%  Similarity=0.534  Sum_probs=16.2

Q ss_pred             HHHHHHHHHHHHHHHCCCCH---HHHHHHHHHHHCC
Q ss_conf             88999999999998839998---8999999888628
Q gi|254780286|r   77 HTIEVSQIARSLARALRIDE---DLVEAIALAHDFG  109 (410)
Q Consensus        77 HslEVa~i~rsi~~~l~~~~---dlvea~~L~HDiG  109 (410)
T Consensus       189 H~~Rv~~~~~~lAe~lgLse~~v~~i~~AapLHDIG  224 (360)
T COG3437         189 HLERVAQYSELLAELLGLSEEEVDLIKKAAPLHDIG  224 (360)
T ss_pred             HHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCHHHCC
T ss_conf             789999999999999678899999999604042133