HHsearch alignment for GI: 254780286 and conserved domain: COG3481

>COG3481 Predicted HD-superfamily hydrolase [General function prediction only].
Probab=91.48  E-value=0.33  Score=28.59  Aligned_cols=69  Identities=20%  Similarity=0.329  Sum_probs=43.5

Q ss_pred             CCCEEECC-------HHHHHHCCC-CEEEE---CCCC---CCCCCCHHHHHHHHHHHHHHHHHC-CCCHHHHHHHHHHHH
Q ss_conf             00011027-------346232757-47871---6999---870662088899999999999883-999889999998886
Q gi|254780286|r   43 DRDRMIHT-------TAFRRLKDK-TQVFF---HRQR---DHYRTRLMHTIEVSQIARSLARAL-RIDEDLVEAIALAHD  107 (410)
Q Consensus        43 D~dRIi~S-------~afRRL~~K-TQVf~---~~~~---d~~rtRLtHslEVa~i~rsi~~~l-~~~~dlvea~~L~HD  107 (410)
T Consensus        97 ~i~~~i~~~e~~~i~~iv~~~~~K~~~~f~~~paa~~~Hh~~~~gLa~ht~~~~~l~~~~~~~y~~~n~dli~Ag~ilHd  176 (287)
T COG3481          97 EITGYIFSIENAVIQRIVRHDLEKIPEVFYKYPAATQNHHAFEGGLAEHTLTVLELYKRISEIYPTVNRELIYAGAILHD  176 (287)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCHHHHHCCCHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHC
T ss_conf             98787311254789999998763134777505024666653221268999999999998775325646889998998832


Q ss_pred             CCCC
Q ss_conf             2899
Q gi|254780286|r  108 FGHP  111 (410)
Q Consensus       108 iGhp  111 (410)
T Consensus       177 igK~  180 (287)
T COG3481         177 IGKV  180 (287)
T ss_pred             CCCC
T ss_conf             4663