HHsearch alignment for GI: 254780286 and conserved domain: COG4341

>COG4341 Predicted HD phosphohydrolase [General function prediction only].
Probab=96.34  E-value=0.0035  Score=43.27  Aligned_cols=65  Identities=29%  Similarity=0.390  Sum_probs=44.0

Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHCCC--CCCCCCHH-HHHHHHHHHCCCCCCCCCHHHHHHHHH
Q ss_conf             870662088899999999999883999889999998886289--98865478-999999731255457765778875432
Q gi|254780286|r   69 DHYRTRLMHTIEVSQIARSLARALRIDEDLVEAIALAHDFGH--PPFGHVGE-DVLQELLSSYGGFDHNIQSFRIVTELE  145 (410)
Q Consensus        69 d~~rtRLtHslEVa~i~rsi~~~l~~~~dlvea~~L~HDiGh--pPFGH~GE-~al~~~~~~~~gFegNaQ~~Rilt~LE  145 (410)
T Consensus        26 ge~VTq~eHaLQ~A----tlAerdGa~~~lV-aaALLHDiGhl~~~~g~~ps~~~i~d~-------~hee~~~~vL~~~f   93 (186)
T COG4341          26 GEPVTQLEHALQCA----TLAERDGADTALV-AAALLHDIGHLYADYGHTPSAAGIDDP-------FHEEFATPVLRKLF   93 (186)
T ss_pred             CCCCHHHHHHHHHH----HHHHHCCCCHHHH-HHHHHHHHHHHHHHCCCCCCCCCCCHH-------HHHHHHHHHHHHHC
T ss_conf             67313666678776----7887628947999-999887688773112799665553006-------78988689999867