HHsearch alignment of GI: 254780286 and MMDB domain: 1u6z_A_313-451

>1u6z_A (A:313-451) Exopolyphosphatase; alpha/beta protein, askha (acetate and sugar kinases, HSC70, actin) superfamily; 1.90A {Escherichia coli}
Probab=93.74  E-value=0.093  Score=32.21  Aligned_cols=112  Identities=12%  Similarity=-0.045  Sum_probs=60.5

Q ss_pred             CCHHHHHHHHHHHHHHHHH------CCCCHH---HHHHHHHHHHCCCCCCCCCHHHHHHHHHHHCCCCCCCCCHHHHHHH
Q ss_conf             6208889999999999988------399988---9999998886289988654789999997312554577657788754
Q gi|254780286|r   73 TRLMHTIEVSQIARSLARA------LRIDED---LVEAIALAHDFGHPPFGHVGEDVLQELLSSYGGFDHNIQSFRIVTE  143 (410)
Q Consensus        73 tRLtHslEVa~i~rsi~~~------l~~~~d---lvea~~L~HDiGhpPFGH~GE~al~~~~~~~~gFegNaQ~~Rilt~  143 (410)
                      .-.+||+.|+.++..|++.      ++++++   .+..|||.||||.---                .-..+.+++.++..
T Consensus        16 ~~~~H~~~v~~la~~l~~~l~~~~~~~l~~~~~~~l~~AallhdiG~~~~----------------~~~l~~~~~~~i~~   79 (139)
T 1u6z_A           16 IDSEQARRVLDTTMQMYEQWREQQPKLAHPQLEALLRWAAMLHEVGLNIN----------------HSGLHRHSAYILQN   79 (139)
T ss_dssp             CCHHHHHHHHHHHHHHHHHHHHHCGGGCCHHHHHHHHHHHHHTTTTTTTC----------------STTHHHHHHHHHHH
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHCCCCC----------------HHHHHHHHHHHHHC
T ss_conf             58888888899999999988653256799679999999999856160038----------------66799989999974


Q ss_pred             HHHCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             32114670100024788877634757788644455210014577667640223133667321798656554432
Q gi|254780286|r  144 LECSYADFDGINLTWETLEGLIGHNGPILPQDLDKPRIIPRIFSDYYHIHGLSLANFASLEGQVAAIADDIAYD  217 (410)
Q Consensus       144 LE~~~~~~~GLNLT~atL~~iiKyp~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~slEa~iveaADDIAY~  217 (410)
                          .+..+=-.+-...+..++.|--...+.. +.|. ..          ++.. ..-...++|+.+||.....
T Consensus        80 ----h~~~g~~~~~~~~ia~ii~~hhe~~dg~-g~p~-~~----------~l~~-~~i~~~a~il~iad~~d~l  136 (139)
T 1u6z_A           80 ----SDLPGFNQEQQLMMATLVRYHRKAIKLD-DLPR-FT----------LFKK-KQFLPLIQLLRLGVLLNNQ  136 (139)
T ss_dssp             ----SCCTTCCHHHHHHHHHHHHTSSSCCCCT-TCCC-CS----------SCCH-HHHHHHHHHHHHHHHTTTT
T ss_pred             ----CCCCCCCHHHHHHHHHHHHHHCCCCCCH-HHHH-HC----------CCCH-HHHHHHHHHHHHHHHHHCC
T ss_conf             ----9889989999999999999847899804-4444-25----------0039-9999999999999997373