HHsearch alignment of GI: 254780286 and MMDB domain: 2hek_A_1-221

>2hek_A (A:1-221) Hypothetical protein; predominantly alpha helical protein with GDP binding site and active site being FAR from EACH other, structural genomics; HET: GDP; 2.00A {Aquifex aeolicus}
Probab=99.97  E-value=1.3e-34  Score=275.16  Aligned_cols=201  Identities=19%  Similarity=0.227  Sum_probs=167.3

Q ss_pred             CCCCHHHCCCCEEECCHHHHHHCCCCEEEEC--CCCCCCCCCHHHHHHHHHHHHHHHHHCCCCH-HHHHHHHHHHHCCCC
Q ss_conf             9998434000011027346232757478716--9998706620888999999999998839998-899999988862899
Q gi|254780286|r   35 LTRSEFQRDRDRMIHTTAFRRLKDKTQVFFH--RQRDHYRTRLMHTIEVSQIARSLARALRIDE-DLVEAIALAHDFGHP  111 (410)
Q Consensus        35 ~~R~~f~rD~dRIi~S~afRRL~~KTQVf~~--~~~d~~rtRLtHslEVa~i~rsi~~~l~~~~-dlvea~~L~HDiGhp  111 (410)
                      --|.+|.++..+||.|++|+||+++||+.+.  .-.+..|||++|||+|+++|+.+++.+..+. +++++|||.||||||
T Consensus        10 hg~i~~~~~~~~ii~t~~fqRLr~i~Qlg~~~~v~p~a~htRfeHSLGV~~la~~~~~~l~~~~~~~i~~AaLLHDiGH~   89 (221)
T 2hek_A           10 YGFVRVGEAGLRLIDSFPFQRLRYVKQLGLAYLVFPSAQHTRFEHSLGVYHITERICESLKVKEKELVKLAGLLHDLGHP   89 (221)
T ss_dssp             TEEEEEEHHHHHHHTSHHHHGGGGSBTTTTGGGTSTTCCCBHHHHHHHHHHHHHHHHHHHTCTTHHHHHHHHHTTTTTCC
T ss_pred             CCCEECCHHHHHHHCCHHHHCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHCCCC
T ss_conf             78886288999981997671545662478563427998366110999999999999999854348899999998612541


Q ss_pred             CCCCCHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCH---HHH-H
Q ss_conf             886547899999973125545776577887543211467010002478887763475778864445521001---457-7
Q gi|254780286|r  112 PFGHVGEDVLQELLSSYGGFDHNIQSFRIVTELECSYADFDGINLTWETLEGLIGHNGPILPQDLDKPRIIP---RIF-S  187 (410)
Q Consensus       112 PFGH~GE~al~~~~~~~~gFegNaQ~~Rilt~LE~~~~~~~GLNLT~atL~~iiKyp~~~~~~~~~~~~~~~---~~~-~  187 (410)
                      ||||.+|++++.++...++|++|++++|+++.++.......|.++++.+++++.|||++.........-...   ... .
T Consensus        90 PfsH~~E~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~ld~D~~Dyl~RD  169 (221)
T 2hek_A           90 PFSHTTEVLLPRERSHEDFTERVIKETEIYEILKQDYSHEDIERLVRITLGKPEDEEEKLLSEIITGEFGSDRMDYLRRD  169 (221)
T ss_dssp             SSSSCHHHHSTTSSSCCCHHHHHHHHSHHHHHHHTTSCHHHHHHHHHHHHTCCSSHHHHHHHHHHHSTTCHHHHHHHHHH
T ss_pred             CCCCCHHHHHHCCCCCHHHHHHHHHCCHHHHHHHHHCCCHHHHHHHHHHHCCCCCCCHHHHHHHHCCCCCHHHHHHCCCC
T ss_conf             11441245521013211678999720179999987512035999999985245675125588875044211134300321


Q ss_pred             HHHHHHCCCCCCCCCHHHHHHHHHHHHHH---HHHHHHHHHHHHHCCHHHH
Q ss_conf             66764022313366732179865655443---2120798998753067763
Q gi|254780286|r  188 DYYHIHGLSLANFASLEGQVAAIADDIAY---DAHDIDDGVRAGLLTVDML  235 (410)
Q Consensus       188 ~~~~~~~~~~~~~~slEa~iveaADDIAY---~~hDlEDai~~gli~~~~l  235 (410)
                      .+....+........+++++|+++|+|||   .++|+||.+.++...++++
T Consensus       170 ~~~~g~~~~~~d~~~l~~~~~~~~d~i~~~~k~~~~ie~~~~~R~~~~~~v  220 (221)
T 2hek_A          170 AYFCGVSYGFFDYDRLISTLRVYENKVVVDESGLRALENFLISRYFMYVQV  220 (221)
T ss_dssp             HHHHTCCSSCCCCHHHHHTEEEETTEEEEEGGGHHHHHHHHHHHHHHHHHT
T ss_pred             HHHHCCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             133056667358999998766423001122405999999999999989999