HHsearch alignment of GI: 254780286 and MMDB domain: 3ccg_A_1-135

>3ccg_A (A:1-135) HD superfamily hydrolase; NP_347894.1, HD domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.50A {Clostridium acetobutylicum atcc 824}
Probab=98.29  E-value=4e-06  Score=64.46  Aligned_cols=113  Identities=18%  Similarity=0.076  Sum_probs=77.5

Q ss_pred             CCHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHCC--CCCCCCCHHHHHHHHHHCCCC
Q ss_conf             620888999999999998839998899999988862899886547899999973125--545776577887543211467
Q gi|254780286|r   73 TRLMHTIEVSQIARSLARALRIDEDLVEAIALAHDFGHPPFGHVGEDVLQELLSSYG--GFDHNIQSFRIVTELECSYAD  150 (410)
Q Consensus        73 tRLtHslEVa~i~rsi~~~l~~~~dlvea~~L~HDiGhpPFGH~GE~al~~~~~~~~--gFegNaQ~~Rilt~LE~~~~~  150 (410)
                      .+.-||+.||.+++.||+.+++|++.+..|||.||||-......--........+..  .-.|...|.++|..+....  
T Consensus        19 ~~~~Hs~~Va~la~~ia~~l~ld~~~~~~aaLlHDIGk~~~~~~~~~~~~~l~~~~~~~~~~h~~~g~~~l~~~~~~~--   96 (135)
T 3ccg_A           19 KRYKHSLGVXDTAVRLAGIYNEDTEKARIAGLVHDCAKKLPGEKIIEICTNEGYELGDEDIRNSYLLHGLAGRILAKK--   96 (135)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHTCCHHHHHHHHHHTTTTTTSCHHHHHHHHHHTTCCCCHHHHTTTTC-CHHHHHHHHHH--
T ss_pred             CHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCCHHHHHHHHCCHHHHHHHHHHH--
T ss_conf             072899999999999999829499999999999985354686999998875367314999986732247999999875--


Q ss_pred             CCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             01000247888776347577886444552100145776676402231336673217986565544
Q gi|254780286|r  151 FDGINLTWETLEGLIGHNGPILPQDLDKPRIIPRIFSDYYHIHGLSLANFASLEGQVAAIADDIA  215 (410)
Q Consensus       151 ~~GLNLT~atL~~iiKyp~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~slEa~iveaADDIA  215 (410)
                       ..++..-...+++..|..+.                           ...+++++|+-+||.++
T Consensus        97 -~~~~~~e~~~~~~~~~~~~~---------------------------~~~~~~a~Ii~~AD~~d  133 (135)
T 3ccg_A           97 -VIGIDDEDVLNAIEFHTTGR---------------------------PNXSLLEKIIYIADYIE  133 (135)
T ss_dssp             -TTCCCCHHHHHHHHTTTTCC---------------------------SSCCHHHHHHHHHHHHS
T ss_pred             -HCCCCHHHHHHHHHHHCCCC---------------------------CCCCHHHHHHHHHHHHC
T ss_conf             -43687599999999728899---------------------------99687999999999716