HHsearch results for GI: 254780286 and protein with PDBid: 2dqb_A

>2dqb_A Deoxyguanosinetriphosphate triphosphohydrolase, putative; dntpase, DNTP, single-stranded DNA, DNA, dGTPase, HD superfamily; 2.20A {Thermus thermophilus HB8}
Probab=100.00  E-value=0  Score=909.52  Aligned_cols=366  Identities=40%  Similarity=0.610  Sum_probs=333.6

Q ss_pred             CCCCCCCCCCCCCHHHCCCCCCCCCCCCCCCHHHCCCCEEECCHHHHHHCCCCEEEECCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             67864658543870333773477888999984340000110273462327574787169998706620888999999999
Q gi|254780286|r    8 GFGHQKKVAYAADPTQSLGRMYPEKRSLTRSEFQRDRDRMIHTTAFRRLKDKTQVFFHRQRDHYRTRLMHTIEVSQIARS   87 (410)
Q Consensus         8 ~~~~~~~~~~a~~~~~~~gR~~~e~~~~~R~~f~rD~dRIi~S~afRRL~~KTQVf~~~~~d~~rtRLtHslEVa~i~rs   87 (410)
                      .++.+.++|||+++.+++||.+||+++++||||+|||||||||+||||||+||||||+.+||||||||||||||||||||
T Consensus        10 ~~~~~~l~~~a~~~~~~~~R~~~e~~~~~R~~f~rD~dRIi~S~afRRL~~KTQVf~~~~~d~~rtRLTHslEVa~i~rs   89 (376)
T 2dqb_A           10 ELEASRLAPYAQKARDTRGRAHPEPESLYRTPYQKDRDRILHTTAFRRLEYKTQVLPGWAGDYYRTRLTHTLEVAQVSRS   89 (376)
T ss_dssp             HHHHHHSCTTSCCGGGCCCCSSCCCCCSSCCHHHHHHHHHHHSHHHHHGGGSCSSSCSCC--CCCCHHHHHHHHHHHHHH
T ss_pred             HHHHHHCCHHHCCCCCCCCCCCCCCCCCCCCCHHHCHHHHHCCHHHHCCCCCCEECCCCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             88875248854696020388878999999981431404887278776145688263079998537767899999999999


Q ss_pred             HHHHCCCCHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHCCCCCCCCCHHHHHHHHHHCC
Q ss_conf             99883999889999998886289988654789999997312554577657788754321146701000247888776347
Q gi|254780286|r   88 LARALRIDEDLVEAIALAHDFGHPPFGHVGEDVLQELLSSYGGFDHNIQSFRIVTELECSYADFDGINLTWETLEGLIGH  167 (410)
Q Consensus        88 i~~~l~~~~dlvea~~L~HDiGhpPFGH~GE~al~~~~~~~~gFegNaQ~~Rilt~LE~~~~~~~GLNLT~atL~~iiKy  167 (410)
                      ||+.+|+|++||||||||||||||||||+||+||++||+++||||||||||||||+||.+++.++||||||+||+|++||
T Consensus        90 i~~~l~~~~~lvea~~L~HDiGhpPFGH~GE~al~~~~~~~~gFegNaQslRilt~Le~~~~~~~GlnLT~~tl~~i~K~  169 (376)
T 2dqb_A           90 IARALGLNEDLTEAIALSHDLGHPPFGHTGEHVLNALMQDHGGFEHNAQALRILTHLEVRYPGFRGLNLTYEVLEGIATH  169 (376)
T ss_dssp             HHHHTTCCHHHHHHHHHHTTTTCCSSTTHHHHHHHHHTTTTTCCCHHHHHHHHHHTTCBCBTTBSBCCCCHHHHHHHHHS
T ss_pred             HHHHHCCCCCHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHCC
T ss_conf             99997547333788886034689987506999999987605898545367787564104688989864647665455403


Q ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHH
Q ss_conf             57788644455210014577667640223133667321798656554432120798998753067763001566888999
Q gi|254780286|r  168 NGPILPQDLDKPRIIPRIFSDYYHIHGLSLANFASLEGQVAAIADDIAYDAHDIDDGVRAGLLTVDMLKEISFLEKHIAS  247 (410)
Q Consensus       168 p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~slEa~iveaADDIAY~~hDlEDai~~gli~~~~l~~~~~~~~~~~~  247 (410)
                      ||+..+...                  ......+++|||||||||||||++||||||+++|+|+++++.+++++.....+
T Consensus       170 ~~~~~~~~~------------------~~~~~~~tlEaqIme~ADDIAY~~hDlEDai~~gli~~~~l~e~~l~~~~~~~  231 (376)
T 2dqb_A          170 EAAYSPGFK------------------PLYEGQGTLEAQVVDLSDAIAYAAHDLDDGFRAGLLHPEELKEVELLQALALE  231 (376)
T ss_dssp             CC-----------------------------CCSCHHHHHHHHHHHHHHHHHHHHHHHHTTCSCGGGGGGSHHHHHHHHH
T ss_pred             CCCCCCCHH------------------HHHHCCCCHHHHHHCCHHCCHHHCCCHHHHHHCCCCCHHHHHHHHHHHHHHHH
T ss_conf             210042034------------------55533587789985541238553558888986699889998645899999998


Q ss_pred             HHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             88654889989999999999999999978886787787515454676442685211147035799999999999985178
Q gi|254780286|r  248 LHDLYGHLDDKRLVHELVRRQITAMVEDVITVSQKRIAHLKPHAIHDIRSAGYRIIDFSDEMTLVDKEIKSMLVKYVYRH  327 (410)
Q Consensus       248 ~~~~~~~~~~~~~~~~l~r~~I~~~i~d~i~~s~~~i~~~~~~~~~di~~~~~~li~fs~~~~~~~k~LK~~l~~~Vy~~  327 (410)
                      ......... ......+++.+++.+|.+++..+.+++........++++..+..++.+|+++....+.+|+|++++||+|
T Consensus       232 ~~~~~~~~~-~~~~~~~~~~~i~~~i~~~i~~~~~~~~~~~~~~~~~i~~~~~~l~~~s~~~~~~~~~lk~fl~~~vy~~  310 (376)
T 2dqb_A          232 EGLDLLRLP-ELDRRVLVRQLLGYFITAAIEATHRRVEEAGVQSAEAVRRHPSRLAALGEEAEKALKALKAFLMERFYRH  310 (376)
T ss_dssp             TTCCTTTCC-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCCSHHHHHHSSSCCCCCCHHHHHHHHHHHHHHHHHTTTS
T ss_pred             HHHHHCCCH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHCCCHHHHHCCCCHHHHHHHHHHHHHHHHCC
T ss_conf             744010231-5677899999874799989999999999821302899972520444311100000347899999999489


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCHHHCCCCHHHHHHHCCCHHCCCEEEHHEECCCCHHHHHHHHHHHH
Q ss_conf             999999999999999999999878884574106776602580000103020006733699999999981
Q gi|254780286|r  328 PSIMTCCNQIANVIRNLFSAYMSDPRKMRGCNQLEYERDMTDSIKARHVGDYLAGMTDSYAIREHHILF  396 (410)
Q Consensus       328 ~~v~~~e~~g~~iI~~Lf~~f~~~p~~l~~~~~~~~~~~~~~~~r~R~V~DYIAGMTD~YAi~ly~kL~  396 (410)
                      +.|+.++.+|++||..||+.|+++|+.||..|+..+    ++..+.|+||||||||||+||+++|++||
T Consensus       311 ~~v~~~e~~g~~iI~~Lf~~f~~~p~llp~~~~~~~----~~~~~~R~V~DYIAGMTD~yA~~ly~~L~  375 (376)
T 2dqb_A          311 PEVLRERRKAEAVLEGLFAAYTRYPELLPREVQAKI----PEEGLERAVCDYIAGMTDRFALEAYRRLS  375 (376)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHCGGGSCHHHHTTH----HHHCHHHHHHHHHHTCCHHHHHHHHHHTC
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCHHHCCHHHHHHC----CCCCHHHEEHHHHCCCHHHHHHHHHHHCC
T ss_conf             999999999999999999999859985999999646----66665623021021631779999999709