HHsearch results for GI: 254780286 and protein with PDBid: 3djb_A

>3djb_A Hydrolase, HD family; all alpha-helical protein., structural genomics, PSI-2, protein structure initiative; 2.90A {Bacillus thuringiensis serovarkonkukian} SCOP: a.211.1.1
Probab=97.65  E-value=6.6e-05  Score=54.38  Aligned_cols=51  Identities=24%  Similarity=0.253  Sum_probs=43.5

Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHCCCCCCCCCHH
Q ss_conf             987066208889999999999988399988999999888628998865478
Q gi|254780286|r   68 RDHYRTRLMHTIEVSQIARSLARALRIDEDLVEAIALAHDFGHPPFGHVGE  118 (410)
Q Consensus        68 ~d~~rtRLtHslEVa~i~rsi~~~l~~~~dlvea~~L~HDiGhpPFGH~GE  118 (410)
                      ++.--+-+.|++-|.+.|+.|++..+.|.++|++|||.||||.++..+.++
T Consensus        20 ~~~~~Hd~~Hi~RV~~~A~~Ia~~e~~D~~vv~~AAlLHDigd~k~~~~~~   70 (223)
T 3djb_A           20 KDASGHDWYHIRRVHKMAISLSEQEGGNRFIIEMAALLHDVADEKLNESEE   70 (223)
T ss_dssp             SSSCTTTHHHHHHHHHHHHHHHTTTCSCHHHHHHHHTTHHHHC--CCSSST
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHCCCCCCCCHHH
T ss_conf             699865889999999999999988599899999999996415412352456