HHsearch results for GI: 254780286 and protein with PDBid: 3irh_A

>3irh_A HD domain protein; phosphohydrolase, dntpase, structural genomics, PSI-2, protein structure initiative; HET: DGT DTP; 2.40A {Enterococcus faecalis V583} PDB: 2o6i_A*
Probab=99.80  E-value=8.8e-19  Score=156.93  Aligned_cols=101  Identities=23%  Similarity=0.388  Sum_probs=80.8

Q ss_pred             CCCCCHHHCC---CCEEECCHHHHHHCCCCE------EEECCCCCCCCCCHHHHHHHHHHHHHHHHHCC-----------
Q ss_conf             9999843400---001102734623275747------87169998706620888999999999998839-----------
Q gi|254780286|r   34 SLTRSEFQRD---RDRMIHTTAFRRLKDKTQ------VFFHRQRDHYRTRLMHTIEVSQIARSLARALR-----------   93 (410)
Q Consensus        34 ~~~R~~f~rD---~dRIi~S~afRRL~~KTQ------Vf~~~~~d~~rtRLtHslEVa~i~rsi~~~l~-----------   93 (410)
                      |+.=...+-|   --+||.|++|.||.+.+|      |||-.    .|||.+|||.|+++|+.+++.|.           
T Consensus        42 Dpihg~I~~~~~~~~~iIdtp~fQRLR~IkQLG~~~lVfPgA----~HtRfeHSLGv~~la~~~~~~l~~~~~~~~~~~~  117 (480)
T 3irh_A           42 DPVHNYIHVQHQVILDLINSAEVQRLRRIKQLGTSSFTFHGA----EHSRFSHSLGVYEITRRICEIFQRNYSVERLGEN  117 (480)
T ss_dssp             ETTTEEEEEEEHHHHHHHTSHHHHGGGGSBSSTTGGGTSTTC----CCBHHHHHHHHHHHHHHHHHHHHHHSBHHHHGGG
T ss_pred             CCCCCEEEECHHHHHHHCCCHHHHCCCCCCCCCCCCCCCCCC----CCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCC
T ss_conf             698730896879999862997772225565478656378898----3072349999999999999999861541002445


Q ss_pred             -CC---HHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHCCCCCCCCCHHHHHHHHHH
Q ss_conf             -99---889999998886289988654789999997312554577657788754321
Q gi|254780286|r   94 -ID---EDLVEAIALAHDFGHPPFGHVGEDVLQELLSSYGGFDHNIQSFRIVTELEC  146 (410)
Q Consensus        94 -~~---~dlvea~~L~HDiGhpPFGH~GE~al~~~~~~~~gFegNaQ~~Rilt~LE~  146 (410)
                       ++   ..++.+|||.|||||+||+|++|...        ++.|+.+|.+++..++.
T Consensus       118 ~~~~~~~~~~~~AaLlHDiGHgPFSH~~E~~~--------~~~He~~s~~ii~~~~~  166 (480)
T 3irh_A          118 GWNDDERLITLCAALLHDVGHGPYSHTFEHIF--------DTNHEAITVQIITSPET  166 (480)
T ss_dssp             SBCGGGHHHHHHHHHHTTTTCCTTHHHHHHHH--------CCCHHHHHHHHHHCTTS
T ss_pred             CCCHHHHHHHHHHHHHHCCCCCCCHHHCCCCC--------CCCHHHHHHHHHHHHHH
T ss_conf             66778899999999986148783211023002--------43357889999972456