HHSEARCH alignment of GI: 254780286 and SCOP domain: d3dy8a1

Alignment
>d3dy8a1 a.211.1.2 (A:182-505) High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A, PDE9A {Human (Homo sapiens) [TaxId: 9606]}
Probab=93.49  E-value=0.041  Score=31.98  Aligned_cols=73  Identities=23%  Similarity=0.406  Sum_probs=45.4

Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHCCCCH-----HH--HHHHHHHHHCCCCCCCCCHHHHHHHHHHH-CCC-----CCCCCC
Q ss_conf             706620888999999999998839998-----89--99999888628998865478999999731-255-----457765
Q gi|254780286|r   70 HYRTRLMHTIEVSQIARSLARALRIDE-----DL--VEAIALAHDFGHPPFGHVGEDVLQELLSS-YGG-----FDHNIQ  136 (410)
Q Consensus        70 ~~rtRLtHslEVa~i~rsi~~~l~~~~-----dl--vea~~L~HDiGhpPFGH~GE~al~~~~~~-~~g-----FegNaQ  136 (410)
                      -+|| -+|+..|+|..-.+-...++..     ++  +=.|||+||+|||=.--......+....- |++     =-|-+.
T Consensus        69 pYHN-~~HA~dV~q~~~~ll~~~~~~~~l~~~e~~alliAal~HD~~HpG~~N~fl~~~~~~la~~ynd~SvlE~~H~~~  147 (324)
T d3dy8a1          69 PFHN-FRHCFCVAQMMYSMVWLCSLQEKFSQTDILILMTAAICHDLDHPGYNNTYQINARTELAVRYNDISPLENHHCAV  147 (324)
T ss_dssp             SSSS-HHHHHHHHHHHHHHHHHTTGGGTSCHHHHHHHHHHHHHTTTTCCSSCHHHHHHHTCHHHHHTTTSSHHHHHHHHH
T ss_pred             CCCC-HHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCHHHHHHCCCHHHHHCCCCCHHHHHHHHH
T ss_conf             9837-999999999999999825544224739999999999997268998775898854877888729987778999999


Q ss_pred             HHHHHHH
Q ss_conf             7788754
Q gi|254780286|r  137 SFRIVTE  143 (410)
Q Consensus       137 ~~Rilt~  143 (410)
                      +++|+.+
T Consensus       148 ~~~ll~~  154 (324)
T d3dy8a1         148 AFQILAE  154 (324)
T ss_dssp             HHHHHTS
T ss_pred             HHHHHCC
T ss_conf             9999718


SCOP domain information

class: All alpha proteins
fold: HD-domain/PDEase-like
superfamily: HD-domain/PDEase-like
family: PDEase
domain: High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A, PDE9A
species: Human (Homo sapiens) [TaxId: 9606]