BLAST/PSIBLAST alignment of GI: 254780286 and GI: 15965275 at iteration 1
>gi|15965275|ref|NP_385628.1| deoxyguanosinetriphosphate triphosphohydrolase-like protein [Sinorhizobium meliloti 1021] Length = 405
>gi|307309298|ref|ZP_07588966.1| deoxyguanosinetriphosphate triphosphohydrolase [Sinorhizobium meliloti BL225C] Length = 405
>gi|307317039|ref|ZP_07596480.1| deoxyguanosinetriphosphate triphosphohydrolase [Sinorhizobium meliloti AK83] Length = 405
>gi|21362481|sp|Q92Q32|DGTL1_RHIME RecName: Full=Deoxyguanosinetriphosphate triphosphohydrolase-like protein Length = 405
>gi|15074455|emb|CAC46101.1| Deoxyguanosinetriphosphate triphosphohydrolase [Sinorhizobium meliloti 1021] Length = 405
>gi|306897127|gb|EFN27872.1| deoxyguanosinetriphosphate triphosphohydrolase [Sinorhizobium meliloti AK83] Length = 405
>gi|306900299|gb|EFN30916.1| deoxyguanosinetriphosphate triphosphohydrolase [Sinorhizobium meliloti BL225C] Length = 405
 Score =  470 bits (1210), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 230/404 (56%), Positives = 295/404 (73%), Gaps = 2/404 (0%)

Query: 1   MIVVRK-LGFGHQKKVAYAADPTQSLGRMYPEKRSLTRSEFQRDRDRMIHTTAFRRLKDK 59
           M V R+ LGFG+ +  AYA++P  S GR+YPE  S TRS+FQRDRDR++HTTAFRRLK K
Sbjct: 1   MTVDRQALGFGYGEHAAYASNPWASRGRLYPEASSPTRSDFQRDRDRIVHTTAFRRLKHK 60

Query: 60  TQVFFHRQRDHYRTRLMHTIEVSQIARSLARALRIDEDLVEAIALAHDFGHPPFGHVGED 119
           TQVF     DHYRTRL HTIEV+QIAR+LARAL++DEDL E +AL HDFGH PFGH GED
Sbjct: 61  TQVFIAADGDHYRTRLTHTIEVAQIARALARALKLDEDLAEGVALVHDFGHTPFGHTGED 120

Query: 120 VLQELLSSYGGFDHNIQSFRIVTELECSYADFDGINLTWETLEGLIGHNGPILPQDLDKP 179
            L E+L  YGGFDHN QS RIVT+LE  YA+FDG+NLTWE+LEGL+ HNGP++  D    
Sbjct: 121 ALHEVLEPYGGFDHNAQSLRIVTKLERRYAEFDGLNLTWESLEGLVKHNGPLMTADGQGL 180

Query: 180 R-IIPRIFSDYYHIHGLSLANFASLEGQVAAIADDIAYDAHDIDDGVRAGLLTVDMLKEI 238
           R  +P+   DY  +H L LA+FASLE QVAAIADDIAY+ HDIDDG+RAG LT +ML+EI
Sbjct: 181 RGPVPQPILDYCALHDLELASFASLEAQVAAIADDIAYNTHDIDDGLRAGYLTFEMLEEI 240

Query: 239 SFLEKHIASLHDLYGHLDDKRLVHELVRRQITAMVEDVITVSQKRIAHLKPHAIHDIRSA 298
            FL + +  +HD Y  L+  R  HE++RRQITAMVEDVI V+QKR+  ++P +  D+R A
Sbjct: 241 PFLARLMREVHDRYPGLESSRFTHEIMRRQITAMVEDVIAVAQKRLGEVRPESAKDVRCA 300

Query: 299 GYRIIDFSDEMTLVDKEIKSMLVKYVYRHPSIMTCCNQIANVIRNLFSAYMSDPRKMRGC 358
           G  +  FSDEM+  D++IK++L+  +YRHP +M      A+++ +L+ A+M DP  M+  
Sbjct: 301 GRVMATFSDEMSETDRQIKNLLMTRIYRHPEVMRVRQGAASIVTDLYRAFMDDPSLMKEH 360

Query: 359 NQLEYERDMTDSIKARHVGDYLAGMTDSYAIREHHILFGYIPDF 402
             ++    M +  +ARHVGDYLAGMTD++AI  H  LF + PD 
Sbjct: 361 YWIDQIAGMAEPARARHVGDYLAGMTDTFAISVHRRLFDHTPDL 404