RPSBLAST alignment of GI: 254780286 and MMDB domain: 2ogi_A_1-159

>2ogi_A (A:1-159) Hypothetical protein SAG1661; NP_688652.1, conserved hypothetical protein TIGR00488, structural genomics; HET: GDP MES; 1.85A {Streptococcus agalactiae serogroup V}Length = 159
 Score = 59.4 bits (143), Expect = 9e-10
 Identities = 19/159 (11%), Positives = 35/159 (22%), Gaps = 30/159 (18%)

Query: 74  RLMHTIEVSQIARSLARALRIDEDLVEAIALAHDFGHPPFGHVGEDVLQELLSSYGGFDH 133
           R  H + V + A  LA     D++     AL HD+           ++ +          
Sbjct: 27  RFNHVLGVERAAIELAERYGYDKEKAGLAALLHDYAKELSDDEFLRLIDKYQPDPDLKKW 86

Query: 134 NIQSFRIVTELECSYADFDGINLTWETLEGLIGHNGPILPQDLDKPRIIPRIFSDYYHIH 193
               +     +       D      + L  +  H                          
Sbjct: 87  GNNIWH--GLVGIYKIQEDLAIKDQDILAAIAKHTVGSAQ-------------------- 124

Query: 194 GLSLANFASLEGQVAAIADDI-AYDAHDIDDGVRAGLLT 231
                   S   ++  +AD I         +  R     
Sbjct: 125 -------XSTLDKIVYVADYIEHNRDFPGVEEARELAKV 156