RPSBLAST alignment of GI: 254780286 and MMDB domain: 3b57_A_

>3b57_A (A:) LIN1889 protein; Q92AN1, X-RAY, NESG, structural genomics, PSI-2, protein structure initiative; 3.00A {Listeria innocua CLIP11262}Length = 209
 Score = 57.2 bits (137), Expect = 4e-09
 Identities = 13/131 (9%), Positives = 39/131 (29%), Gaps = 9/131 (6%)

Query: 43  DRDRMIHTTAFRRLKDKTQVFFHRQRDHYRTRLMHTIEVSQIARSLARALRIDEDLVEAI 102
             + ++    +     +         +       H   V ++++ +      D   +E  
Sbjct: 3   KEEIILSAKNWXHSHFEN--------ETTGHDWSHIKRVWKLSKEIQSKEGGDLFTIELA 54

Query: 103 ALAHDFGHPPFGHVGEDVLQELLSSYGGFDHNIQSFRIVTEL-ECSYADFDGINLTWETL 161
           AL HD+         ++  + L++     +   +  + +  + +              T+
Sbjct: 55  ALFHDYSDIKLTTDEQEATKTLINWXETKEIPSELIKKIIRIIQSVSFKKGKNTFKALTI 114

Query: 162 EGLIGHNGPIL 172
           E  I  +   L
Sbjct: 115 EEKIVQDADRL 125