RPSBLAST alignment of GI: 254780286 and MMDB domain: 3bg2_A_1-119_180-360

>3bg2_A (A:1-119,A:180-360) DGTP triphosphohydrolase; structural genomics, NYSGXRC, target 10395N, PSI-2, protein structure initiative; 1.95A {Leeuwenhoekiella blandensis MED217}Length = 300
 Score =  125 bits (315), Expect = 1e-29
 Identities = 63/347 (18%), Positives = 108/347 (31%), Gaps = 92/347 (26%)

Query: 17  YAADPTQSLGRMYPEKRSLTRSEFQRDRDRMIHTTAFRRLKDKTQVFFHRQRDHYRTRLM 76
            +        +    ++  TR  F+ D DR+I +  FR L+DKTQV    + D   TRL 
Sbjct: 8   LSLKRQGDTAKRLRIEQDDTRLGFEVDYDRIIFSAPFRSLQDKTQVIPLSKTDFVHTRLT 67

Query: 77  HTIEVSQIARSLARALRI-------------------DEDLVEAIALAHDFGHPPFGHVG 117
           H++EVS + RSL R +                        +V A ALAHD G        
Sbjct: 68  HSLEVSVVGRSLGRMVGKKLLEKYPHLEQVYGYKFNDFGAIVAAAALAHDIG-------- 119

Query: 118 EDVLQELLSSYGGFDHNIQSFRIVTELECSYADFDGINLTWETLEGLIGHNGPILPQDLD 177
                                                 L++ TL   + +    LP    
Sbjct: 120 -------------------------------------RLSYATLGAFMKYPKESLPHKPS 142

Query: 178 KPRIIPR--IFSDYYHI--------------HGLSLANFASLEGQVAAIADDIAYDAHDI 221
                 +   F     +                  ++        +   ADDI Y   D 
Sbjct: 143 DHIADKKYGFFQSERALFEDVAQELGLLKRSTTDDVSWSRHPLAYLVEAADDICYTIIDF 202

Query: 222 DDGVRAGLLTVDMLKEI-SFLEKHIASLHDLYGHLDDKRLVHELVRRQITAMVEDVITVS 280
           +DG+  GL+  +   E    L       +      +    V  L    I  ++ + +   
Sbjct: 203 EDGINLGLIPEEYALEYMVKLVGQTIDRNKYNALQETSDRVSYLRALAIGTLINESVDTF 262

Query: 281 QKRIAHLKPHAIHDIRSAGYR--IIDFSDEMTLVDKEIKSMLVKYVY 325
            K           +I +  +   +ID S+    +  +I ++ ++ +Y
Sbjct: 263 MKY--------EEEILAGTFDQSLIDKSNYQAQI-TDIINLSIERIY 300