RPSBLAST alignment of GI: 254780286 and protein with PDBid: 2dqb

>2dqb_A Deoxyguanosinetriphosphate triphosphohydrolase, putative; dntpase, DNTP, single-stranded DNA, DNA, dGTPase, HD superfamily; 2.20A {Thermus thermophilus HB8} Length = 376
 Score =  292 bits (747), Expect = 1e-79
 Identities = 142/380 (37%), Positives = 199/380 (52%), Gaps = 23/380 (6%)

Query: 17  YAADPTQSLGRMYPEKRSLTRSEFQRDRDRMIHTTAFRRLKDKTQVFFHRQRDHYRTRLM 76
           YA     + GR +PE  SL R+ +Q+DRDR++HTTAFRRL+ KTQV      D+YRTRL 
Sbjct: 19  YAQKARDTRGRAHPEPESLYRTPYQKDRDRILHTTAFRRLEYKTQVLPGWAGDYYRTRLT 78

Query: 77  HTIEVSQIARSLARALRIDEDLVEAIALAHDFGHPPFGHVGEDVLQELLSSYGGFDHNIQ 136
           HT+EV+Q++RS+ARAL ++EDL EAIAL+HD GHPPFGH GE VL  L+  +GGF+HN Q
Sbjct: 79  HTLEVAQVSRSIARALGLNEDLTEAIALSHDLGHPPFGHTGEHVLNALMQDHGGFEHNAQ 138

Query: 137 SFRIVTELECSYADFDGINLTWETLEGLIGHNGPILPQDLDKPRIIPRIFSDYYHIHGLS 196
           + RI+T LE  Y  F G+NLT+E LEG+  H                     Y       
Sbjct: 139 ALRILTHLEVRYPGFRGLNLTYEVLEGIATHEAA------------------YSPGFKPL 180

Query: 197 LANFASLEGQVAAIADDIAYDAHDIDDGVRAGLLTVDMLKEISFLEKHIASLHDLYGHLD 256
                +LE QV  ++D IAY AHD+DDG RAGLL  + LKE+  L+            L 
Sbjct: 181 YEGQGTLEAQVVDLSDAIAYAAHDLDDGFRAGLLHPEELKEVELLQALALEEGLDLLRLP 240

Query: 257 DKRLVHELVRRQITAMVEDVITVSQKRIAHLKPHAIHDIRSAGYRIIDFSDEMTLVDKEI 316
           +      LVR+ +   +   I  + +R+      +   +R    R+              
Sbjct: 241 ELD-RRVLVRQLLGYFITAAIEATHRRVEEAGVQSAEAVRRHPSRLAALGXXXXXXXXXX 299

Query: 317 KSMLVKYVYRHPSIMTCCNQIANVIRNLFSAYMSDPRKMRGCNQLEYERDMTDSIKARHV 376
              L++  YRHP ++    +   V+  LF+AY   P  +      E +  + +    R V
Sbjct: 300 XXFLMERFYRHPEVLRERRKAEAVLEGLFAAYTRYPELL----PREVQAKIPEEGLERAV 355

Query: 377 GDYLAGMTDSYAIREHHILF 396
            DY+AGMTD +A+  +  L 
Sbjct: 356 CDYIAGMTDRFALEAYRRLS 375