RPSBLAST alignment of GI: 254780286 and protein with PDBid: 2o08

>2o08_A BH1327 protein; NP_242193.1, hypothetical protein, structural genomics, joint center for structural genomics, JCSG, PSI-2; HET: UNL PG4 DGI; 1.90A {Bacillus halodurans} Length = 188
 Score = 39.4 bits (91), Expect = 0.002
 Identities = 13/37 (35%), Positives = 18/37 (48%)

Query: 74  RLMHTIEVSQIARSLARALRIDEDLVEAIALAHDFGH 110
           R  HTI V + A  LA+    D+   E  A+ HD+  
Sbjct: 19  RYQHTIGVMETAIDLAKLYGADQQKAELAAIFHDYAK 55