RPSBLAST alignment of GI: 254780286 and protein with PDBid: 2pgs

>2pgs_A Putative deoxyguanosinetriphosphate triphosphohydrolase; deoxyguanosinetriphosphate triphsphohydrolase; 2.35A {Pseudomonas syringae PV} Length = 451
 Score =  275 bits (704), Expect = 1e-74
 Identities = 95/437 (21%), Positives = 150/437 (34%), Gaps = 60/437 (13%)

Query: 22  TQSLGRMYPEKRSLTRSEFQRDRDRMIHTTAFRRLKDKTQVFFHRQRDHYRTRLMHTIEV 81
            + LG+       L RS F +D DR+I + AFRRL  KTQV      DH  TRL H++EV
Sbjct: 11  RERLGKTLHSPEELGRSPFHKDHDRIIFSGAFRRLGRKTQVHPVSSNDHIHTRLTHSLEV 70

Query: 82  SQIARSLARALRID--------------EDLVEAIALAHDFGHPPFGHVGEDVLQELLSS 127
           S + RSL   +                   +V++  LAHD G+PPFGH GED ++   + 
Sbjct: 71  SCVGRSLGMRVGETLRAALPDWCDPSDLGMVVQSACLAHDIGNPPFGHSGEDAIRNWFNQ 130

Query: 128 YGG-----------------FDHNIQSFRIVTELECSYADFDGINLTWETLEGLIGHNGP 170
             G                 F+ N Q FR++T+LE    D  G  LT+ TL   + +   
Sbjct: 131 AAGRGWLDAMSETERNDFLNFEGNAQGFRVLTQLEYHQFDG-GTRLTYATLGTYLKYPWT 189

Query: 171 ILPQDLDKPRIIPRIFSDYYHIHGLSLANF------------ASLEGQVAAIADDIAYDA 218
               D    +                +A                    +   ADDI Y  
Sbjct: 190 ARHADSLGYKKHKFGCYQSELPILEQIAGKLGLPQLEEQRWARHPLVYLMEAADDICYAL 249

Query: 219 HDIDDGVRAGLLTVDMLKEISFLEKHIASLHDLYGHLDDKRLVHELVRRQITAMVEDVIT 278
            D++DG+   LL    ++ +  L      L + Y  L         +       +E +  
Sbjct: 250 IDLEDGLEMDLLDYAEVESL-LLGLVGDDLPETYRQLGPGDSRRRKLAILRGKAIEHLTN 308

Query: 279 VSQKRIAHLKPHAIHDIRSAGYRIIDFSDEMTLVDKEIKSMLVKYVYRHPSIMTCCNQIA 338
            + +     +  A+      G  +              K M  K +++            
Sbjct: 309 AAARAFVE-QQDALLAGTLPGDLVEHMHGPAKRCVLNAKDMARKKIFQDKRKTLHEIGAY 367

Query: 339 NVIRNLFSAYMSDPRKMRGCNQLEY--------------ERDMTDSIKARHVGDYLAGMT 384
             +  L +A+     +  G     +              +           + D++AGMT
Sbjct: 368 TTLEILLNAFCGAAVEQFGGRTPSFKHRRILDLLGNSAPDPKAPLHASFLRMIDFIAGMT 427

Query: 385 DSYAIREHHILFGYIPD 401
           DSYA      + G   +
Sbjct: 428 DSYASEMAREMTGRSGE 444