RPS-BLAST 2.2.22 [Sep-27-2009]

Database: CddA 
           21,609 sequences; 6,263,737 total letters

Searching..................................................done

Query= gi|254780287|ref|YP_003064700.1| iron-sulfur cluster assembly
accessory protein [Candidatus Liberibacter asiaticus str. psy62]
         (109 letters)



>gnl|CDD|30664 COG0316, IscA, Uncharacterized conserved protein [Function
           unknown].
          Length = 110

 Score =  138 bits (349), Expect = 3e-34
 Identities = 49/110 (44%), Positives = 75/110 (68%), Gaps = 1/110 (0%)

Query: 1   MVPIIKITDAAATQIKTILESNSDK-KALRITIEGGGCSGFSYKFDLESKQSEDDIVFEK 59
              +I +TDAAA ++K +L    ++   LR+ ++GGGCSGF Y  + + + +EDD VFE+
Sbjct: 1   AAMMITLTDAAAARVKALLAKEGEENLGLRVGVKGGGCSGFQYGLEFDDEINEDDTVFEQ 60

Query: 60  NGAQIFIDKISLAYLTNSEIDFVDNLLSKSFQIRNPNATSNCGCGTSFSI 109
           +G ++ +D  SL YL  +EID+V++LL   F  +NPNA S+CGCG SFS+
Sbjct: 61  DGVKVVVDPKSLPYLEGTEIDYVEDLLGSGFTFKNPNAKSSCGCGESFSV 110


>gnl|CDD|110518 pfam01521, Fe-S_biosyn, Iron-sulphur cluster biosynthesis.  This
          family is involved in iron-sulphur cluster
          biosynthesis. Its members include proteins that are
          involved in nitrogen fixation such as the HesB and
          HesB-like proteins.
          Length = 91

 Score =  110 bits (277), Expect = 1e-25
 Identities = 42/91 (46%), Positives = 55/91 (60%)

Query: 5  IKITDAAATQIKTILESNSDKKALRITIEGGGCSGFSYKFDLESKQSEDDIVFEKNGAQI 64
          I +TDAAA  IK +L+    +  LRI +  GGCSGFSY    E +  E D VFE++G  +
Sbjct: 1  ITLTDAAAKWIKKLLDLEGGENGLRIGVRYGGCSGFSYGLTFEDEAGEGDEVFEQDGVTV 60

Query: 65 FIDKISLAYLTNSEIDFVDNLLSKSFQIRNP 95
           +D+ SL YL  +EIDFV+ LL   F   NP
Sbjct: 61 VVDEKSLPYLEGTEIDFVEELLGSGFTFSNP 91


>gnl|CDD|36335 KOG1119, KOG1119, KOG1119, Mitochondrial Fe-S cluster biosynthesis
           protein ISA2 (contains a HesB-like domain) [Energy
           production and conversion, Intracellular trafficking,
           secretion, and vesicular transport].
          Length = 199

 Score =  107 bits (267), Expect = 8e-25
 Identities = 45/107 (42%), Positives = 73/107 (68%), Gaps = 3/107 (2%)

Query: 4   IIKITDAAATQIKTILESNSDKKALRITIEGGGCSGFSYKFDLESKQSEDDIVFEKNGAQ 63
            + ++D+ + ++K I E++   + LR+T+EGGGCSGF YKF L++K + DD VF +NGA+
Sbjct: 93  NLHLSDSCSKRLKEIYENS--PEFLRLTVEGGGCSGFQYKFRLDNKINNDDRVFVENGAR 150

Query: 64  IFIDKISLAYLTNSEIDFVDNLLSKSFQI-RNPNATSNCGCGTSFSI 109
           + +D +SL  L  + +D+ + L+  SF+I  NP+A   C CG+SF I
Sbjct: 151 VVVDNVSLNLLKGATVDYTNELIRSSFRIVNNPSAKQGCSCGSSFDI 197


>gnl|CDD|36336 KOG1120, KOG1120, KOG1120, Fe-S cluster biosynthesis protein ISA1
           (contains a HesB-like domain) [Inorganic ion transport
           and metabolism].
          Length = 134

 Score = 96.6 bits (240), Expect = 1e-21
 Identities = 40/107 (37%), Positives = 61/107 (57%)

Query: 3   PIIKITDAAATQIKTILESNSDKKALRITIEGGGCSGFSYKFDLESKQSEDDIVFEKNGA 62
             + +T +A   IK +L    +   LRI ++  GC+G SY  +    + + D V E++G 
Sbjct: 28  AALTLTPSAVNHIKQLLSDKPEDVCLRIGVKQRGCNGLSYTLEYTKTKGKFDEVVEQDGV 87

Query: 63  QIFIDKISLAYLTNSEIDFVDNLLSKSFQIRNPNATSNCGCGTSFSI 109
           +IFI+  +L  L  +E+D+VD+ LS  F   NPNA   CGCG SFS+
Sbjct: 88  RIFIEPKALLTLIGTEMDYVDDKLSSEFVFSNPNAKGTCGCGESFSV 134


>gnl|CDD|147326 pfam05091, eIF-3_zeta, Eukaryotic translation initiation factor 3
           subunit 7 (eIF-3).  This family is made up of eukaryotic
           translation initiation factor 3 subunit 7 (eIF-3
           zeta/eIF3 p66/eIF3d). Eukaryotic initiation factor 3 is
           a multi-subunit complex that is required for binding of
           mRNA to 40 S ribosomal subunits, stabilisation of
           ternary complex binding to 40 S subunits, and
           dissociation of 40 and 60 S subunits. These functions
           and the complex nature of eIF3 suggest multiple
           interactions with many components of the translational
           machinery. The gene coding for the protein has been
           implicated in cancer in mammals.
          Length = 509

 Score = 27.7 bits (62), Expect = 0.68
 Identities = 11/29 (37%), Positives = 14/29 (48%), Gaps = 5/29 (17%)

Query: 54  DIVFEKNGAQIFIDKISLAYLTNSEIDFV 82
           DIV  K G ++F DK        S ID +
Sbjct: 252 DIVITKVGNKLFFDKRD-----GSNIDLL 275


>gnl|CDD|113619 pfam04853, Invertase_neut, Plant neutral invertase.  This family
           represents a number of plant neutral invertases
           (EC:3.2.1.26).
          Length = 473

 Score = 27.5 bits (61), Expect = 0.83
 Identities = 15/45 (33%), Positives = 25/45 (55%), Gaps = 3/45 (6%)

Query: 60  NGAQIFI-DKI--SLAYLTNSEIDFVDNLLSKSFQIRNPNATSNC 101
           N  Q+FI D +  ++A+L   E D V N L  + Q+++   T +C
Sbjct: 44  NYDQVFIRDFVPSAIAFLLKGEGDIVRNFLLHTLQLQSWEKTVDC 88


>gnl|CDD|33115 COG3306, COG3306, Glycosyltransferase involved in LPS biosynthesis
           [Cell envelope biogenesis, outer membrane].
          Length = 255

 Score = 26.5 bits (58), Expect = 1.9
 Identities = 13/58 (22%), Positives = 24/58 (41%), Gaps = 2/58 (3%)

Query: 52  EDDIVFEKNGAQIFIDKISLAYLTNSEIDFVDNLLSKSFQIRNPNATSNCGCGTSFSI 109
           EDD+V  ++  +    +  L        D +D    ++F   NP A +    G +F +
Sbjct: 94  EDDVVLGEDFEEFL--EDDLKLPVRFLGDDIDIHRLETFLSPNPLAFNAVFIGRNFPL 149


>gnl|CDD|132723 cd02736, RNAP_III_Rpc1_C, Largest subunit (Rpc1) of Eukaryotic RNA
           polymerase III (RNAP III), C-terminal domain.
           Eukaryotic RNA polymerase III (RNAP III) is a large
           multi-subunit complex responsible for the synthesis of
           tRNAs, 5SrRNA, Alu-RNA, U6 snRNA, among others. Rpc1 is
           also known as C160 in yeast. Structure studies suggest
           that different RNA polymerase complexes share a similar
           crab-claw-shape structure. The C-terminal domain of
           Rpb1, the largest subunit of RNAP II, makes up part of
           the foot and jaw structures of RNAP II. The similarity
           between this domain and the C-terminal domain of Rpb1,
           its counterpart in RNAP II, suggests a similar
           functional and structural role.
          Length = 300

 Score = 24.9 bits (55), Expect = 5.1
 Identities = 26/99 (26%), Positives = 39/99 (39%), Gaps = 15/99 (15%)

Query: 2   VPIIKITDAAATQIKTI-----LESNSDKKALRITIEGGGCSGFSYKFDLESKQSEDDIV 56
           VP IK    A+  I T      LE++ D+K+ RI        G   K  L    S  + V
Sbjct: 47  VPRIKEIINASKNISTPIITAKLENDRDEKSARI------VKGRIEKTYLGEVASYIEEV 100

Query: 57  FEKNGA--QIFIDK--ISLAYLTNSEIDFVDNLLSKSFQ 91
           +  +     I +DK  I    L+ S + F+   L +   
Sbjct: 101 YSPDDCYILIKLDKKIIEKLQLSKSNLYFLLQSLKRKLP 139


  Database: CddA
    Posted date:  Feb 4, 2011  9:38 PM
  Number of letters in database: 6,263,737
  Number of sequences in database:  21,609
  
Lambda     K      H
   0.316    0.133    0.368 

Gapped
Lambda     K      H
   0.267   0.0789    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 21609
Number of Hits to DB: 1,172,850
Number of extensions: 52201
Number of successful extensions: 142
Number of sequences better than 10.0: 1
Number of HSP's gapped: 140
Number of HSP's successfully gapped: 15
Length of query: 109
Length of database: 6,263,737
Length adjustment: 75
Effective length of query: 34
Effective length of database: 4,643,062
Effective search space: 157864108
Effective search space used: 157864108
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 51 (23.3 bits)