RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780287|ref|YP_003064700.1| iron-sulfur cluster assembly accessory protein [Candidatus Liberibacter asiaticus str. psy62] (109 letters) >d1s98a_ b.124.1.1 (A:) Fe-S scaffold protein IscA (YfhF) {Escherichia coli [TaxId: 562]} Length = 97 Score = 96.2 bits (239), Expect = 6e-22 Identities = 30/95 (31%), Positives = 54/95 (56%) Query: 5 IKITDAAATQIKTILESNSDKKALRITIEGGGCSGFSYKFDLESKQSEDDIVFEKNGAQI 64 I ++D+AA ++ T L + LR+ + GCSG +Y + + + +DIVFE G ++ Sbjct: 2 ITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTPEDIVFEDKGVKV 61 Query: 65 FIDKISLAYLTNSEIDFVDNLLSKSFQIRNPNATS 99 +D S+ +L +++DFV L++ F+ NPN Sbjct: 62 VVDGKSMQFLDGTQLDFVKEGLNEGFKFTNPNVKD 96 >d1nwba_ b.124.1.1 (A:) Hypothetical protein Aq_1857 {Aquifex aeolicus [TaxId: 63363]} Length = 101 Score = 86.3 bits (213), Expect = 6e-19 Identities = 37/93 (39%), Positives = 54/93 (58%), Gaps = 1/93 (1%) Query: 4 IIKITDAAATQIKTIL-ESNSDKKALRITIEGGGCSGFSYKFDLESKQSEDDIVFEKNGA 62 I K+TD A +IK + E+N + LRI + GGCSGF Y + E D VFE +G Sbjct: 9 IFKVTDKAVEEIKKVAQENNIENPILRIRVVPGGCSGFQYAMGFDDTVEEGDHVFEYDGV 68 Query: 63 QIFIDKISLAYLTNSEIDFVDNLLSKSFQIRNP 95 ++ ID S+ Y+ +E+D+V + + F IRNP Sbjct: 69 KVVIDPFSMPYVNGAELDYVVDFMGGGFTIRNP 101 >d1xgsa2 d.127.1.1 (A:1-194,A:272-295) Methionine aminopeptidase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 218 Score = 25.0 bits (53), Expect = 2.0 Identities = 8/36 (22%), Positives = 12/36 (33%), Gaps = 3/36 (8%) Query: 30 ITIEGGGCSGFSYKFDLESKQSEDDIVFEKNGAQIF 65 IE G + Q E I+ EK+ + Sbjct: 184 FAIEPFATIG---ARNGIVAQFEHTIIVEKDSVIVT 216 >d1b6aa2 d.127.1.1 (A:110-374,A:449-478) Methionine aminopeptidase {Human (Homo sapiens) [TaxId: 9606]} Length = 295 Score = 24.1 bits (51), Expect = 3.3 Identities = 7/38 (18%), Positives = 12/38 (31%), Gaps = 2/38 (5%) Query: 30 ITIEGGGCSGFSY--KFDLESKQSEDDIVFEKNGAQIF 65 IE G +G + Q E I+ ++ Sbjct: 252 YAIETFGSTGKGVVDIKGSYTAQFEHTILLRPTCKEVV 289 >d1nvus_ a.117.1.1 (S:) Son of sevenless protein homolog 1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 481 Score = 24.0 bits (51), Expect = 3.9 Identities = 8/21 (38%), Positives = 13/21 (61%), Gaps = 2/21 (9%) Query: 41 SYKFDLESKQSEDDIVFEKNG 61 Y+F SE++I+FE+N Sbjct: 9 VYRFAEPD--SEENIIFEENM 27 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.316 0.133 0.368 Gapped Lambda K H 0.267 0.0608 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 387,087 Number of extensions: 15472 Number of successful extensions: 59 Number of sequences better than 10.0: 1 Number of HSP's gapped: 58 Number of HSP's successfully gapped: 15 Length of query: 109 Length of database: 2,407,596 Length adjustment: 68 Effective length of query: 41 Effective length of database: 1,473,956 Effective search space: 60432196 Effective search space used: 60432196 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.1 bits)