>pfam04542 Sigma70_r2 Sigma-70 region 2. Region 2 of sigma-70 is the most conserved region of the entire protein. All members of this class of sigma-factor contain region 2. The high conservation is due to region 2 containing both the -10 promoter recognition helix and the primary core RNA polymerase binding determinant. The core binding helix, interacts with the clamp domain of the largest polymerase subunit, beta prime. The aromatic residues of the recognition helix, found at the C-terminus of this domain are though to mediate strand separation, thereby allowing transcription initiation.

Probab=98.54 E-value=2.1e-07 Score=77.40 Aligned_cols=71 Identities=39% Similarity=0.570 Sum_probs=67.3 Q ss_pred HHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCEEEHHHHHHHHHHHHHHHHHCCCE Q ss_conf 98755578999887522356777887544367999988743854573120102898999999999722870 Q gi|254780289|r 448 MVEANLRLVISVAKKYTNRGLQFLDLIQEGNIGLMKAAEKFDWCLGYKFSTYAMWWVKQAITRSIADQSCT 518 (682) Q Consensus 448 l~~anlr~v~~~~~~~~~~~~~~~~~~~~~~~~l~~a~~~~~~~~g~~f~tya~~~i~~~i~~~~~~~~~~ 518 (682) T Consensus 1 L~~~y~~~l~~~~~~~~~~~~~aeDl~Qe~f~~~~~~~~~~~~~~~~~f~~wl~~i~~n~~~d~~Rk~~r~ 71 (71) T pfam04542 1 LVERYLPLVYSLARRYLGDGADAEDLVQEGFLGLLRAVERFDPERGVSFSTWLYTIIRNAIIDALRKQRRT 71 (71) T ss_pred CHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCC T ss_conf 99989999999999883986029999999999999998757961366099899999999999999973999

HHsearch alignment for GI: 254780289 and conserved domain: pfam04542