HHsearch alignment for GI: 254780290 and conserved domain: CHL00194

>CHL00194 ycf39 Ycf39; Provisional.
Probab=97.78  E-value=6.3e-06  Score=58.34  Aligned_cols=99  Identities=17%  Similarity=0.204  Sum_probs=67.9

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222113444443222221222222221112232211111122332222-222221111222222222111222211111
Q gi|254780290|r  147 QTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAI-NYLKEDFLEILQKETQGRGIDIILDMVGAE  225 (332)
Q Consensus       147 ~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~vi-~~~~~~~~~~i~~~t~g~g~Divid~~G~~  225 (332)
T Consensus         1 M~ILV~GATG~lGr~vVr~Ll~~G~~Vr~lvRnp~ka~~l~~~Gve~v~gDl~dp---esl~~Al--~GvdaVi~~~~~~   75 (319)
T CHL00194          1 MSLLVIGATGTLGRQIVRRALDEGYQVKCLVRNLRKAAFLKEWGAELVYGDLSLP---ETIPPAL--EGITAIIDASTSR   75 (319)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHCCCEEEEECCCCH---HHHHHHH--CCCCEEEEECCCC
T ss_conf             9799989985899999999996889089995786763234215967999427887---7899996--5996799945667


Q ss_pred             C-----CC--------CCCCCCCCCC--CCEEEEECCCCC
Q ss_conf             1-----22--------2221122345--304798337875
Q gi|254780290|r  226 Y-----LN--------QHLTLLSKEG--KLIIISFLGGNI  250 (332)
Q Consensus       226 ~-----~~--------~~~~~l~~~G--~iv~~G~~~~~~  250 (332)
T Consensus        76 ~~~~~~~~~vd~~g~~~li~AAk~aGVkr~V~lS~lga~~  115 (319)
T CHL00194         76 PSDLNNAYQIDLEGKLALIEAAKAAKVKRFIFFSILNAEQ  115 (319)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCC
T ss_conf             7886208898898899999999984998899961356666