HHsearch alignment for GI: 254780290 and conserved domain: COG0604

>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only].
Probab=100.00  E-value=0  Score=477.41  Aligned_cols=321  Identities=39%  Similarity=0.655  Sum_probs=293.2

Q ss_pred             EEEEEECCCCCCCEEEEEEECCCCCCCCEEEEEEEEEEECHHHHHHHCCCCCCCCCCCCEECCCCCCCCCCCCCCCCCCC
Q ss_conf             08999915688530799982378778862899999998278789998688778766873003300023222222122222
Q gi|254780290|r    7 MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTHWN   86 (332)
Q Consensus         7 Mka~v~~~~g~~~~l~~~~~~~P~~~~~~vlV~v~~~~in~~D~~~~~G~~~~~~~~p~v~G~e~~G~V~~vG~~v~~~~   86 (332)
T Consensus         1 mka~~~~~~g~~~~l~~~e~~~P~p~~geVlV~V~aagvN~~D~~~r~G~~~~~~~~P~i~G~d~aG~V~avG~~V~~~~   80 (326)
T COG0604           1 MKAVVVEEFGGPEVLKVVEVPEPEPGPGEVLVRVKAAGVNPIDVLVRQGLAPPVRPLPFIPGSEAAGVVVAVGSGVTGFK   80 (326)
T ss_pred             CCEEEEECCCCCCCEEEEECCCCCCCCCEEEEEEEEEECCHHHHHHHCCCCCCCCCCCCCCCEEEEEEEEECCCCCCCCC
T ss_conf             90399832689862169867899999996999998986174888873388787688997540157899996378988778


Q ss_pred             CCCCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             233332211---22333332211111112222222322212222223332221112222222222221134444432222
Q gi|254780290|r   87 IGDEVCALV---NGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAI  163 (332)
Q Consensus        87 ~GdrV~~~~---~~G~~ae~~~~~~~~~~~iP~~~s~~~aa~l~~~~~tA~~~l~~~~~~~~g~~vlV~ga~g~vG~~a~  163 (332)
T Consensus        81 ~GdrV~~~~~~~~~G~~AEy~~v~a~~~~~~P~~ls~~eAA~l~~~~~TA~~~l~~~~~l~~g~~VLv~gaaGgVG~~ai  160 (326)
T COG0604          81 VGDRVAALGGVGRDGGYAEYVVVPADWLVPLPDGLSFEEAAALPLAGLTAWLALFDRAGLKPGETVLVHGAAGGVGSAAI  160 (326)
T ss_pred             CCCEEEECCCCCCCCCCEEEEECCHHHEEECCCCCCHHHHHHCCCHHHHHHHHHHHHCCCCCCCEEEEECCCCHHHHHHH
T ss_conf             99889985888889865126770556728789999989985522306769999997617699997999778546999999


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEE
Q ss_conf             21222222221112232211111122332222222221111222222222111222211111122222112234530479
Q gi|254780290|r  164 QLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIII  243 (332)
Q Consensus       164 qla~~~G~~vi~~~~~~~~~~~~~~lGa~~vi~~~~~~~~~~i~~~t~g~g~Divid~~G~~~~~~~~~~l~~~G~iv~~  243 (332)
T Consensus       161 QlAk~~G~~~v~~~~s~~k~~~~~~lGAd~vi~y~~~d~~~~v~~~t~g~gvDvv~D~vG~~~~~~~l~~l~~~G~lv~i  240 (326)
T COG0604         161 QLAKALGATVVAVVSSSEKLELLKELGADHVINYREEDFVEQVRELTGGKGVDVVLDTVGGDTFAASLAALAPGGRLVSI  240 (326)
T ss_pred             HHHHHCCCCEEEEECCHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHCCCCCCEEEECCCHHHHHHHHHHHCCCCEEEEE
T ss_conf             99998499589998175788999873998897056424899999983799878899798679999999974259589998


Q ss_pred             EECCCCCCCCCCCCHHHCCCCEEEEEEECCCHHCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHH--HHHHHHHHHC
Q ss_conf             83378754322243343053216777512400011378999999999999986983102124741899--9999999982
Q gi|254780290|r  244 SFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGK--VAMAHDIMEK  321 (332)
Q Consensus       244 G~~~~~~~~~~~~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~--i~~A~~~l~~  321 (332)
T Consensus       241 g~~~g~~~~~~~~~~~~~~~~~~~g~~~~~~---~~-~~~~~~~~~l~~~l~~g~l~~~i~~~~~l~e~~~a~a~~~~~-  315 (326)
T COG0604         241 GALSGGPPVPLNLLPLLGKRLTLRGVTLGSR---DP-EALAEALAELFDLLASGKLKPVIDRVYPLAEAPAAAAHLLLE-  315 (326)
T ss_pred             ECCCCCCCCCCCCHHHCCCEEEEEEECCCCC---CH-HHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHC-
T ss_conf             0688776445330311015169996414236---76-778999999999997698502235453766768999999855-


Q ss_pred             CCCCCEEEEEC
Q ss_conf             99813289839
Q gi|254780290|r  322 SEHIGKIILLP  332 (332)
Q Consensus       322 g~~~GKvVi~P  332 (332)
T Consensus       316 ~~~~GKvvl~~  326 (326)
T COG0604         316 RRTTGKVVLKV  326 (326)
T ss_pred             CCCCCEEEEEC
T ss_conf             88861699859