HHsearch alignment for GI: 254780290 and conserved domain: COG1063

>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only].
Probab=100.00  E-value=0  Score=328.11  Aligned_cols=309  Identities=30%  Similarity=0.460  Sum_probs=249.4

Q ss_pred             EEEEEECCCCCCCEEEEEEECCCCCCCCEEEEEEEEEEECHHHHHHHCCCCCCCCCCCC-EECCCCCCCCCCCCCCCCCC
Q ss_conf             08999915688530799982378778862899999998278789998688778766873-00330002322222212222
Q gi|254780290|r    7 MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANP-ILGLEVAGKIVDLGENTTHW   85 (332)
Q Consensus         7 Mka~v~~~~g~~~~l~~~~~~~P~~~~~~vlV~v~~~~in~~D~~~~~G~~~~~~~~p~-v~G~e~~G~V~~vG~~v~~~   85 (332)
T Consensus         1 m~a~~~~~~~~--~~~~~~~~~p~~~p~~vlVkv~~~gICGSDlh~~~g~~~~~~-~~~~i~GHE~~G~V~evG-~~~~~   76 (350)
T COG1063           1 MKAAVVYVGGG--DVRLEEPPPPIPGPGDVLIRVTATGICGSDLHIYRGGEPFVP-PGDIILGHEFVGEVVEVG-VVRGF   76 (350)
T ss_pred             CCEEEEECCCC--CEEEEECCCCCCCCCEEEEEEEEEEECCCCHHHHCCCCCCCC-CCCCCCCCEEEEEEEEEC-CCCCC
T ss_conf             96799954898--147520688889998399999998786324797658997656-888766641148999988-71575


Q ss_pred             CCCCCCCCC------------------C--------------CCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCC
Q ss_conf             223333221------------------1--------------223333322111111122-2222232221222222333
Q gi|254780290|r   86 NIGDEVCAL------------------V--------------NGGGYAEYCLSHQGHTLP-IPKGYNAIQAASLPESFFT  132 (332)
Q Consensus        86 ~~GdrV~~~------------------~--------------~~G~~ae~~~~~~~~~~~-iP~~~s~~~aa~l~~~~~t  132 (332)
T Consensus        77 ~~GdrVvv~~~~~Cg~C~~C~~G~~~~C~~~~~~g~~~~~~~~~G~~aEyv~vp~~~~~~~~pd~~-~~~~aal~epla~  155 (350)
T COG1063          77 KVGDRVVVEPNIPCGHCRYCRAGEYNLCENPGFYGYAGLGGGIDGGFAEYVRVPADFNLAKLPDGI-DEEAAALTEPLAT  155 (350)
T ss_pred             CCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEECHHHCEEECCCCC-CHHHECCCCCHHH
T ss_conf             489999977765899880103898120467543352233377787246899976687856089999-7553201580998


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222111222222222222113444443222221222222-22111223221111112-2332222222221111222222
Q gi|254780290|r  133 VWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGA-TVYTTAKSEEKCLACLK-LGAKHAINYLKEDFLEILQKET  210 (332)
Q Consensus       133 A~~~l~~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~-~vi~~~~~~~~~~~~~~-lGa~~vi~~~~~~~~~~i~~~t  210 (332)
T Consensus       156 ~~~~~a~~~~~~~~~~V~V~G-aGpIGLla~~~a~~~Ga~~Viv~d~~~~Rl~~A~~~~g~~~~~~~~~~~~~~~~~~~t  234 (350)
T COG1063         156 AYHGHAERAAVRPGGTVVVVG-AGPIGLLAIALAKLLGASVVIVVDRSPERLELAKEAGGADVVVNPSEDDAGAEILELT  234 (350)
T ss_pred             HHHHHHHHCCCCCCCEEEEEC-CCHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHCCCCEEECCCCHHHHHHHHHHC
T ss_conf             999998424578899899988-8899999999998769827999799989999999877971872463014788999860


Q ss_pred             CCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCHHHCCCCEEEEEEE-CCCHHCCHHHHHHHHHH
Q ss_conf             22211122221111-11222221122345304798337875432224334305321677751-24000113789999999
Q gi|254780290|r  211 QGRGIDIILDMVGA-EYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTL-RRRTDIAKQSIRDSLQL  288 (332)
Q Consensus       211 ~g~g~Divid~~G~-~~~~~~~~~l~~~G~iv~~G~~~~~~~~~~~~~~~~~~~~~i~g~~~-~~~~~~~~~~~~~~~~~  288 (332)
T Consensus       235 ~g~g~D~vie~~G~~~~~~~ai~~~r~gG~v~~vGv~~~~~~-~~~~~~~~~kel~l~g~~~~~~~~~~----------~  303 (350)
T COG1063         235 GGRGADVVIEAVGSPPALDQALEALRPGGTVVVVGVYGGEDI-PLPAGLVVSKELTLRGSLRPSGREDF----------E  303 (350)
T ss_pred             CCCCCCEEEECCCCHHHHHHHHHHCCCCCEEEEEECCCCCCC-CCCHHHHHHCCEEEECCCCCCCCCCH----------H
T ss_conf             898799999998997999999996025989999951588666-56888997535089734566564019----------9


Q ss_pred             HHHHHHHCCCCCC--CCEEEEEHHHHHHHHHHHHCCCC-CCEEEEEC
Q ss_conf             9999998698310--21247418999999999982998-13289839
Q gi|254780290|r  289 KIWPLLNSHVIAP--VIHTVLPLGKVAMAHDIMEKSEH-IGKIILLP  332 (332)
Q Consensus       289 ~~~~~i~~g~l~p--~i~~~~~l~~i~~A~~~l~~g~~-~GKvVi~P  332 (332)
T Consensus       304 ~~~~ll~~g~i~~~~lit~~~~l~~~~~a~~~~~~~~~~~iKv~i~~  350 (350)
T COG1063         304 RALDLLASGKIDPEKLITHRLPLDDAAEAYELFADRKEEAIKVVLKP  350 (350)
T ss_pred             HHHHHHHCCCCCHHHHCCEECCHHHHHHHHHHHHCCCCCCEEEEEEC
T ss_conf             99999985998807730243478889999999860677744999839