HHsearch alignment for GI: 254780290 and conserved domain: COG1064

>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only].
Probab=100.00  E-value=0  Score=456.77  Aligned_cols=309  Identities=33%  Similarity=0.516  Sum_probs=283.0

Q ss_pred             CCCEEEEEECCCCCCCEEEEEEECCCCCCCCEEEEEEEEEEECHHHHHHHCCCCCCCCCCCCEECCCCCCCCCCCCCCCC
Q ss_conf             76208999915688530799982378778862899999998278789998688778766873003300023222222122
Q gi|254780290|r    4 CKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTT   83 (332)
Q Consensus         4 ~~~Mka~v~~~~g~~~~l~~~~~~~P~~~~~~vlV~v~~~~in~~D~~~~~G~~~~~~~~p~v~G~e~~G~V~~vG~~v~   83 (332)
T Consensus         1 ~~~mkA~~~~~~~~p--l~i~e~~~p~p~~~eVlI~v~~~GVChsDlH~~~G~~~~~~-~P~ipGHEivG~V~~vG~~V~   77 (339)
T COG1064           1 MMTMKAAVLKKFGQP--LEIEEVPVPEPGPGEVLIKVEACGVCHTDLHVAKGDWPVPK-LPLIPGHEIVGTVVEVGEGVT   77 (339)
T ss_pred             CCCEEEEEECCCCCC--CEEEECCCCCCCCCEEEEEEEEEEECCHHHHHHCCCCCCCC-CCCCCCCCEEEEEEEECCCCC
T ss_conf             963289986168999--55786668999988089999998626055465527788888-982688535799998658986


Q ss_pred             CCCCCCCCC----------------------------CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222233332----------------------------2112233333221111111222222232221222222333222
Q gi|254780290|r   84 HWNIGDEVC----------------------------ALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWA  135 (332)
Q Consensus        84 ~~~~GdrV~----------------------------~~~~~G~~ae~~~~~~~~~~~iP~~~s~~~aa~l~~~~~tA~~  135 (332)
T Consensus        78 ~~k~GDrVgV~~~~~~Cg~C~~C~~G~E~~C~~~~~~gy~~~GGyaeyv~v~~~~~~~iP~~~d~~~aApllCaGiT~y~  157 (339)
T COG1064          78 GLKVGDRVGVGWLVISCGECEYCRSGNENLCPNQKITGYTTDGGYAEYVVVPARYVVKIPEGLDLAEAAPLLCAGITTYR  157 (339)
T ss_pred             CCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCCCEEEEEECHHHEEECCCCCCHHHHHHHHCCEEEEEE
T ss_conf             47789998857743689998020485501288766265560584211799765785888899986661154367005760


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             11122222222222211344444322222122222222111223221111112233222222222111122222222211
Q gi|254780290|r  136 NLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGI  215 (332)
Q Consensus       136 ~l~~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~vi~~~~~~~~~~i~~~t~g~g~  215 (332)
T Consensus       158 alk~-~~~~pG~~V~I~G~-GGlGh~avQ~Aka~ga~Via~~~~~~K~e~a~~lGAd~~i~~~~~~~~~~~~~~-----~  230 (339)
T COG1064         158 ALKK-ANVKPGKWVAVVGA-GGLGHMAVQYAKAMGAEVIAITRSEEKLELAKKLGADHVINSSDSDALEAVKEI-----A  230 (339)
T ss_pred             EHHH-CCCCCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCEEEECCCCHHHHHHHHH-----C
T ss_conf             0465-38999989999877-489999999999869969999578779999998488289976781166776734-----7


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCHHHCCCCEEEEEEECCCHHCCHHHHHHHHHHHHHHHHH
Q ss_conf             12222111111222221122345304798337875432224334305321677751240001137899999999999998
Q gi|254780290|r  216 DIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLN  295 (332)
Q Consensus       216 Divid~~G~~~~~~~~~~l~~~G~iv~~G~~~~~~~~~~~~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~i~  295 (332)
T Consensus       231 d~ii~tv~~~~~~~~l~~l~~~G~~v~vG~~~~~~~~~~~~~~li~~~~~i~GS~~g~~~d~----------~e~l~f~~  300 (339)
T COG1064         231 DAIIDTVGPATLEPSLKALRRGGTLVLVGLPGGGPIPLLPAFLLILKEISIVGSLVGTRADL----------EEALDFAA  300 (339)
T ss_pred             CEEEECCCHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCHHHHHHCCCEEEEEECCCHHHH----------HHHHHHHH
T ss_conf             39999877455999999864297899978888766666787786326708999724899999----------99999998


Q ss_pred             CCCCCCCCEEEEEHHHHHHHHHHHHCCCCCCEEEEEC
Q ss_conf             6983102124741899999999998299813289839
Q gi|254780290|r  296 SHVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIILLP  332 (332)
Q Consensus       296 ~g~l~p~i~~~~~l~~i~~A~~~l~~g~~~GKvVi~P  332 (332)
T Consensus       301 ~g~Ikp~i~e~~~l~~in~A~~~m~~g~v~gR~Vi~~  337 (339)
T COG1064         301 EGKIKPEILETIPLDEINEAYERMEKGKVRGRAVIDM  337 (339)
T ss_pred             HCCCEEEEEEEECHHHHHHHHHHHHCCCEEEEEEECC
T ss_conf             1894324876677899999999987288116999567