HHsearch alignment for GI: 254780290 and conserved domain: KOG1202

>KOG1202 consensus.
Probab=100.00  E-value=5.7e-44  Score=309.94  Aligned_cols=304  Identities=25%  Similarity=0.374  Sum_probs=265.1

Q ss_pred             CCCCEEEEEEECCC--C-CCCCEEEEEEEEEEECHHHHHHHCCCCCCCC------CCCCEECCCCCCCCCCCCCCCCCCC
Q ss_conf             88530799982378--7-7886289999999827878999868877876------6873003300023222222122222
Q gi|254780290|r   16 GKSNVMFLAESPIP--Q-PQKEEILIKVEAIGVNRPDVMQRKGLYPPPK------NANPILGLEVAGKIVDLGENTTHWN   86 (332)
Q Consensus        16 g~~~~l~~~~~~~P--~-~~~~~vlV~v~~~~in~~D~~~~~G~~~~~~------~~p~v~G~e~~G~V~~vG~~v~~~~   86 (332)
T Consensus      1424 GDlsSlrWies~~~~a~~~~~~~e~CtVYYAplNFRDiMLasGkL~~DAiPG~~a~qdclLGmEFsGR----------d~ 1493 (2376)
T KOG1202        1424 GDLSSLRWIESPLRHAQPTCPGLELCTVYYAPLNFRDIMLASGKLSPDAIPGDLASQDCLLGMEFSGR----------DA 1493 (2376)
T ss_pred             CCCCCEEEEECCHHHCCCCCCCCCEEEEEECCCCHHHHHHHCCCCCCCCCCCCCCHHHHEECEEECCC----------CC
T ss_conf             65110044405121037778887325789714447888776078784558874200100003033165----------67


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             23333221122333332211111112222222322212222223332221112222222222221134444432222212
Q gi|254780290|r   87 IGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLA  166 (332)
Q Consensus        87 ~GdrV~~~~~~G~~ae~~~~~~~~~~~iP~~~s~~~aa~l~~~~~tA~~~l~~~~~~~~g~~vlV~ga~g~vG~~a~qla  166 (332)
T Consensus      1494 ~GrRvM~mvpAksLATt~l~~rd~lWevP~~WTleeAstVP~VYsTaYYALVvRG~mkkGekiLIHaGsGGVGQAAIaiA 1573 (2376)
T KOG1202        1494 SGRRVMGMVPAKSLATTVLASRDFLWEVPSKWTLEEASTVPVVYSTAYYALVVRGQMKKGEKILIHAGSGGVGQAAIAIA 1573 (2376)
T ss_pred             CCCEEEEEEEHHHHHHHHHCCHHHHHHCCCCCCHHHCCCCCEEEEEEHHHHHHHCCCCCCCEEEEECCCCCHHHHHHHHH
T ss_conf             78588774003554554200630352088534264446575576310223332024467867999527873308999999


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEE
Q ss_conf             2222222111223221111112----233222222222111122222222211122221111112222211223453047
Q gi|254780290|r  167 SYFGATVYTTAKSEEKCLACLK----LGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLII  242 (332)
Q Consensus       167 ~~~G~~vi~~~~~~~~~~~~~~----lGa~~vi~~~~~~~~~~i~~~t~g~g~Divid~~G~~~~~~~~~~l~~~G~iv~  242 (332)
T Consensus      1574 La~G~~VFTTVGSaEKRefL~~rFPqLqe~~~~NSRdtsFEq~vl~~T~GrGVdlVLNSLaeEkLQASiRCLa~~GRFLE 1653 (2376)
T KOG1202        1574 LAHGCTVFTTVGSAEKREFLLKRFPQLQETNFANSRDTSFEQHVLWHTKGRGVDLVLNSLAEEKLQASIRCLALHGRFLE 1653 (2376)
T ss_pred             HHCCCEEEEECCCHHHHHHHHHHCHHHHHHCCCCCCCCCHHHHHHHHHCCCCEEEEHHHHHHHHHHHHHHHHHHCCEEEE
T ss_conf             97487799841738889999985613332224665565599999987069872320555569998887899974675556


Q ss_pred             EEECCCCCCCCCCCCHHHCCCCEEEEEEECCCHHCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHCC
Q ss_conf             98337875432224334305321677751240001137899999999999998698310212474189999999999829
Q gi|254780290|r  243 ISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKS  322 (332)
Q Consensus       243 ~G~~~~~~~~~~~~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~g  322 (332)
T Consensus      1654 IGKfDLSqNspLGM-avfLkNvsfHGiLLDsvmege-~e~~~ev~~Lv~eGIksGvV~PL~ttvF~~~qvE~AFRfMasG 1731 (2376)
T KOG1202        1654 IGKFDLSQNSPLGM-AVFLKNVSFHGILLDSVMEGE-EEMWREVAALVAEGIKSGVVRPLPTTVFHGQQVEDAFRFMASG 1731 (2376)
T ss_pred             ECCEECCCCCCCHH-HHHHCCCCEEEEEHHHHHCCC-HHHHHHHHHHHHHHHCCCCEECCCCCCCCHHHHHHHHHHHHCC
T ss_conf             40041356885216-664225613124445561674-8999999999986521585231455434577799999988645


Q ss_pred             CCCCEEEEE
Q ss_conf             981328983
Q gi|254780290|r  323 EHIGKIILL  331 (332)
Q Consensus       323 ~~~GKvVi~  331 (332)
T Consensus      1732 KHIGKVvik 1740 (2376)
T KOG1202        1732 KHIGKVVIK 1740 (2376)
T ss_pred             CCCCEEEEE
T ss_conf             733359999