HHsearch alignment for GI: 254780290 and conserved domain: KOG1210

>KOG1210 consensus.
Probab=91.71  E-value=0.021  Score=35.02  Aligned_cols=80  Identities=30%  Similarity=0.365  Sum_probs=52.4

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCC---CCCCCCCC-----C----CCCCCC
Q ss_conf             222222221134444432222212222222211122322111111-2233222---22222211-----1----122222
Q gi|254780290|r  143 LRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACL-KLGAKHA---INYLKEDF-----L----EILQKE  209 (332)
Q Consensus       143 ~~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~-~lGa~~v---i~~~~~~~-----~----~~i~~~  209 (332)
T Consensus        30 ~k~~~hi~itggS~glgl~la~e~~~~ga~Vti~ar~~~kl~~a~~~l~l~~~~~~v~~~S~d~~~Y~~v~~~~~~l~~~  109 (331)
T KOG1210          30 PKPRRHILITGGSSGLGLALALECKREGADVTITARSGKKLLEAKAELELLTQVEDVSYKSVDVIDYDSVSKVIEELRDL  109 (331)
T ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHC
T ss_conf             67662699816841566899999997037429994648789998743114443530367535530289999887632330


Q ss_pred             CCCCCCCCCCCCCCC
Q ss_conf             222211122221111
Q gi|254780290|r  210 TQGRGIDIILDMVGA  224 (332)
Q Consensus       210 t~g~g~Divid~~G~  224 (332)
T Consensus       110 ~~--~~d~l~~cAG~  122 (331)
T KOG1210         110 EG--PIDNLFCCAGV  122 (331)
T ss_pred             CC--CCCEEEEECCC
T ss_conf             48--95027870676