HHsearch alignment for GI: 254780290 and conserved domain: KOG1502

>KOG1502 consensus.
Probab=93.98  E-value=0.0073  Score=38.06  Aligned_cols=46  Identities=30%  Similarity=0.281  Sum_probs=38.7

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC---CCCCCCC
Q ss_conf             222222113444443222221222222221112232211---1111223
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKC---LACLKLG  190 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~---~~~~~lG  190 (332)
T Consensus         5 ~~~~VcVTGAsGfIgswivk~LL~rGY~V~gtVR~~~~~k~~~~L~~l~   53 (327)
T KOG1502           5 EGKKVCVTGASGFIGSWIVKLLLSRGYTVRGTVRDPEDEKKTEHLRKLE   53 (327)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHCC
T ss_conf             8727999488208999999999868998999970863056589998651