HHsearch alignment for GI: 254780290 and conserved domain: PRK01683

>PRK01683 trans-aconitate 2-methyltransferase; Provisional.
Probab=95.67  E-value=0.0016  Score=42.44  Aligned_cols=97  Identities=16%  Similarity=0.243  Sum_probs=64.5

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             122222222222211344444322222122-2222221112232211111122332222222221111222222222111
Q gi|254780290|r  138 FQTANLRSGQTVLIHGGSSGIGTTAIQLAS-YFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGID  216 (332)
Q Consensus       138 ~~~~~~~~g~~vlV~ga~g~vG~~a~qla~-~~G~~vi~~~~~~~~~~~~~~lGa~~vi~~~~~~~~~~i~~~t~g~g~D  216 (332)
T Consensus        24 l~~l~~~~~~~vlDlG-C-G~G~~t~~l~~r~p~a~v~GiD~S~~Ml~~Ar~~~~~~--~f~~~D----~~~~~~~~~~D   95 (252)
T PRK01683         24 LARVPLENVEYVADLG-C-GPGNSTALLHQRWPAARITGIDSSPAMLAEARQALPDC--QFVEAD----IRNWQPEQALD   95 (252)
T ss_pred             HHCCCCCCCCEEEEEC-C-CCCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHCCCC--EEEECC----HHCCCCCCCCC
T ss_conf             8418888999899937-7-49899999999779987999989899999999758998--387250----42078767878


Q ss_pred             CCCCCCC----C---CCCCCCCCCCCCCCCCEE
Q ss_conf             2222111----1---112222211223453047
Q gi|254780290|r  217 IILDMVG----A---EYLNQHLTLLSKEGKLII  242 (332)
Q Consensus       217 ivid~~G----~---~~~~~~~~~l~~~G~iv~  242 (332)
T Consensus        96 ~ifSNaalhW~~d~~~~~~~~~~~L~PGG~la~  128 (252)
T PRK01683         96 LIYANASLQWLPDHYELFPHLVSLLAPQGVLAV  128 (252)
T ss_pred             EEEEEEEHHHCCCHHHHHHHHHHHCCCCCEEEE
T ss_conf             895610045078779999999982487879999