HHsearch alignment for GI: 254780290 and conserved domain: PRK05134

>PRK05134 3-demethylubiquinone-9 3-methyltransferase; Provisional.
Probab=95.93  E-value=0.00092  Score=44.00  Aligned_cols=95  Identities=22%  Similarity=0.245  Sum_probs=62.7

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCCCCC--
Q ss_conf             2222222113444443222221222222221112232211111122332--222222221111222222222111222--
Q gi|254780290|r  144 RSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAK--HAINYLKEDFLEILQKETQGRGIDIIL--  219 (332)
Q Consensus       144 ~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~--~vi~~~~~~~~~~i~~~t~g~g~Divi--  219 (332)
T Consensus        47 l~G~~ILDVG-CG-gG~lse~LAr-~Ga~VtGID~S~~~I~~Ar~ha~~~~l~i~y~~~~~e~l~~~--~~~~FDvV~~~  121 (233)
T PRK05134         47 LFGKRVLDVG-CG-GGILSESMAR-LGATVTGIDASEENIEVARLHALESGLKIDYRQITAEELAAE--HPGQFDVVTCM  121 (233)
T ss_pred             CCCCEEEEEC-CC-CCHHHHHHHH-CCCEEEEECCCHHHHHHHHHHHHHCCCCCEEEECCHHHHHHH--CCCCEEEEEEE
T ss_conf             6899899975-58-9711289996-799799987998999999998564434511675147665430--57863477442


Q ss_pred             ---CCCC--CCCCCCCCCCCCCCCCCEEE
Q ss_conf             ---2111--11122222112234530479
Q gi|254780290|r  220 ---DMVG--AEYLNQHLTLLSKEGKLIII  243 (332)
Q Consensus       220 ---d~~G--~~~~~~~~~~l~~~G~iv~~  243 (332)
T Consensus       122 EVlEHV~d~~~~l~~~~rlLKPGG~l~ls  150 (233)
T PRK05134        122 EMLEHVPDPASFIRACAKLVKPGGLVFFS  150 (233)
T ss_pred             HHHHHCCCHHHHHHHHHHHHCCCCEEEEE
T ss_conf             14775389999999999973899149997