HHsearch alignment for GI: 254780290 and conserved domain: PRK05599

>PRK05599 hypothetical protein; Provisional.
Probab=94.96  E-value=0.0014  Score=42.70  Aligned_cols=74  Identities=24%  Similarity=0.298  Sum_probs=45.7

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCCC----CCCCCCCC----CCCCCCCCCCCC
Q ss_conf             222211344444322222122222222111223221111----112233222----22222211----112222222221
Q gi|254780290|r  147 QTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLA----CLKLGAKHA----INYLKEDF----LEILQKETQGRG  214 (332)
Q Consensus       147 ~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~----~~~lGa~~v----i~~~~~~~----~~~i~~~t~g~g  214 (332)
T Consensus         1 MtvlITGASsGIG~a~A~~lA-~G~~vvl~~R~~e~l~~l~~~l~~~g~~~v~~~~~Dvtd~~~~~~~v~~~~~~~--g~   77 (246)
T PRK05599          1 MSILILGGTSDIAGEIATLLA-HGEDVVLAARRPEAAGGLAEDLRQLGATSVHVLSFDATDLDSHRELVKQTQELA--GE   77 (246)
T ss_pred             CEEEEECCCHHHHHHHHHHHH-CCCCEEEEECCHHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHC--CC
T ss_conf             989998886899999999998-599499999999999999999986259718997289999999999999999861--98


Q ss_pred             CCCCCCCCC
Q ss_conf             112222111
Q gi|254780290|r  215 IDIILDMVG  223 (332)
Q Consensus       215 ~Divid~~G  223 (332)
T Consensus        78 id~lv~naG   86 (246)
T PRK05599         78 ISLAVVAFG   86 (246)
T ss_pred             CEEEEECCC
T ss_conf             439998776