HHsearch alignment for GI: 254780290 and conserved domain: PRK05653

>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated.
Probab=95.89  E-value=0.00047  Score=45.95  Aligned_cols=177  Identities=20%  Similarity=0.263  Sum_probs=93.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCC---CCCCCCCC----CCCCCCCCCCCC
Q ss_conf             2222221134444432222212222222211122322111111----223322---22222221----111222222222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACL----KLGAKH---AINYLKED----FLEILQKETQGR  213 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~----~lGa~~---vi~~~~~~----~~~~i~~~t~g~  213 (332)
T Consensus         4 ~~Kv~lITGgs~GIG~a~a~~la~~G~~V~~~~r~~~~l~~~~~~~~~~~~~~~~~~~Dl~~~~~~~~~~~~~~~~~--g   81 (246)
T PRK05653          4 QGKTALVTGASRGIGRAIALRLAADGARVVIYDSNEEAAEALAEELRAAGGEAALLVFDVTDEAAVRALIEAAVERF--G   81 (246)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHC--C
T ss_conf             99889993897589999999999879999999799999999999999659948999972899999999999999974--9


Q ss_pred             CCCCCCCCCCCC----C-------CC---------------CCCCCCC--CCCCCEEEEECCCCCCCCCC----------
Q ss_conf             111222211111----1-------22---------------2221122--34530479833787543222----------
Q gi|254780290|r  214 GIDIILDMVGAE----Y-------LN---------------QHLTLLS--KEGKLIIISFLGGNIATEIN----------  255 (332)
Q Consensus       214 g~Divid~~G~~----~-------~~---------------~~~~~l~--~~G~iv~~G~~~~~~~~~~~----------  255 (332)
T Consensus        82 ~iDilvnnAg~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~~~m~~~~~G~II~isS~~~~~~~~~~~~Y~asKaal  161 (246)
T PRK05653         82 GLDVLVNNAGITRDALLPRMSEEDWDRVIDTNLTGTFNVCRAALPPMRKARYGRIVNISSVSGVAGNPGQTNYAAAKAGV  161 (246)
T ss_pred             CCCEEEECCCCCCCCCCHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEECCHHHCCCCCCCHHHHHHHHHH
T ss_conf             98699989999999880139999999999986088999999999999984699789983655467899966689999999


Q ss_pred             --C-----CHHHCCCCEEEEEEECCCHHCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHCCC---CC
Q ss_conf             --4-----3343053216777512400011378999999999999986983102124741899999999998299---81
Q gi|254780290|r  256 --L-----NPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSE---HI  325 (332)
Q Consensus       256 --~-----~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~g~---~~  325 (332)
T Consensus       162 ~~lt~~la~e~~~~~IrvN~I~PG~i~T~~~~~~~----~~~~~~~~~~--~P-l~R~~~p~dia~~v~fL~S~~s~~it  234 (246)
T PRK05653        162 IGLTKALALELASRGITVNAVAPGFIDTDMTRALP----EEVKEALLKQ--IP-LGRLGTPEEVANAVAFLASDAASYIT  234 (246)
T ss_pred             HHHHHHHHHHHHHHCEEEEEEEECCCCCCCCCCCC----HHHHHHHHHC--CC-CCCCCCHHHHHHHHHHHHCCHHCCCC
T ss_conf             99999999995043939999963888772311168----9999999847--99-89983999999999999687112835


Q ss_pred             CEEEE
Q ss_conf             32898
Q gi|254780290|r  326 GKIIL  330 (332)
Q Consensus       326 GKvVi  330 (332)
T Consensus       235 G~~i~  239 (246)
T PRK05653        235 GQVIP  239 (246)
T ss_pred             CCEEE
T ss_conf             87488