HHsearch alignment for GI: 254780290 and conserved domain: PRK06113

>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated.
Probab=95.49  E-value=0.00083  Score=44.32  Aligned_cols=178  Identities=16%  Similarity=0.197  Sum_probs=93.1

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCC---CCCCCCCC----CCCCCCCCCCC
Q ss_conf             222222113444443222221222222221112232211111----12233222---22222211----11222222222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC----LKLGAKHA---INYLKEDF----LEILQKETQGR  213 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~----~~lGa~~v---i~~~~~~~----~~~i~~~t~g~  213 (332)
T Consensus        10 ~gKvalVTGas~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~l~~~g~~~~~~~~Dv~~~~~~~~~v~~~~~~~G--   87 (255)
T PRK06113         10 DGKCAIITGAGAGIGKEIAITFATAGASVVVSDINADAANHVVDEIQQLGGQAFACRCDITSEQELSALADFAVSKLG--   87 (255)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHHC--
T ss_conf             999899958877899999999998799999996988999999999996599089998368999999999999999819--


Q ss_pred             CCCCCCCCCCCC---CCC----------------------CCCCCCC--CCCCCEEEEECCCCCCCCCC-----------
Q ss_conf             111222211111---122----------------------2221122--34530479833787543222-----------
Q gi|254780290|r  214 GIDIILDMVGAE---YLN----------------------QHLTLLS--KEGKLIIISFLGGNIATEIN-----------  255 (332)
Q Consensus       214 g~Divid~~G~~---~~~----------------------~~~~~l~--~~G~iv~~G~~~~~~~~~~~-----------  255 (332)
T Consensus        88 ~iDilVnNAG~~~~~~~d~~~~~~~~~~~~Nl~~~~~~~~~~~p~m~~~~~G~IInisS~~~~~~~~~~~~Y~asKaav~  167 (255)
T PRK06113         88 KVDILVNNAGGGGPKPFDMPMADFRRAYELNVFSFFHLSQLVAPEMEKNGGGVILTITSMAAENKNINMTSYASSKAAAS  167 (255)
T ss_pred             CCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEHHHCCCCCCCHHHHHHHHHHH
T ss_conf             98899987887899877599999999999964999999999999888718967999844654688998520899999999


Q ss_pred             ------CCHHHCCCCEEEEEEECCCHHCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHC---CCCCC
Q ss_conf             ------433430532167775124000113789999999999999869831021247418999999999982---99813
Q gi|254780290|r  256 ------LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEK---SEHIG  326 (332)
Q Consensus       256 ------~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~---g~~~G  326 (332)
T Consensus       168 ~ltk~lA~ela~~gIrVN~V~PG~i~T---~~~~~~~~~~~~~~~~~~--~P-l~R~g~pediA~~v~fL~S~~a~~itG  241 (255)
T PRK06113        168 HLVRNMAFDLGEKNIRVNGIAPGAILT---DALKSVITPEIEQKMLQH--TP-IRRLGQPQDIANAALFLCSPAASWVSG  241 (255)
T ss_pred             HHHHHHHHHHHHCCEEEEEEEECCCCC---CHHHHCCCHHHHHHHHHC--CC-CCCCCCHHHHHHHHHHHHCCHHCCCCC
T ss_conf             999999999826494999986488987---022201799999999857--99-889829999999999994814279668


Q ss_pred             EEEE
Q ss_conf             2898
Q gi|254780290|r  327 KIIL  330 (332)
Q Consensus       327 KvVi  330 (332)
T Consensus       242 ~~i~  245 (255)
T PRK06113        242 QILT  245 (255)
T ss_pred             CEEE
T ss_conf             8699