HHsearch alignment for GI: 254780290 and conserved domain: PRK06128

>PRK06128 oxidoreductase; Provisional.
Probab=96.50  E-value=0.00023  Score=47.95  Aligned_cols=182  Identities=18%  Similarity=0.173  Sum_probs=91.7

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC------CCCCCCCCCCC---CCCCCCCCC----CCC
Q ss_conf             22222222222113444443222221222222221112232211------11112233222---222222111----122
Q gi|254780290|r  140 TANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKC------LACLKLGAKHA---INYLKEDFL----EIL  206 (332)
Q Consensus       140 ~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~------~~~~~lGa~~v---i~~~~~~~~----~~i  206 (332)
T Consensus        50 ~grL-~GKvAlVTGgssGIG~AiA~~lA~eGA~Vvi~~~~~~~~~a~~~~~~i~~~G~~a~~v~~Dvsd~~~~~~~v~~~  128 (300)
T PRK06128         50 FGRL-QGRKALITGADSGIGRATAIAFAREGADIVLNYLPEEEQDAAEVVQLIQAEGRKAVAVPGDLKDEAFCRQLVERA  128 (300)
T ss_pred             CCCC-CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHH
T ss_conf             8878-999589917366999999999998699999942995567899999999965981899974789999999999999


Q ss_pred             CCCCCCCCCCCCCCCCCCC----CC-----------------------CCCCCCCCCCCCCEEEEECCCCCCCCCC----
Q ss_conf             2222222111222211111----12-----------------------2222112234530479833787543222----
Q gi|254780290|r  207 QKETQGRGIDIILDMVGAE----YL-----------------------NQHLTLLSKEGKLIIISFLGGNIATEIN----  255 (332)
Q Consensus       207 ~~~t~g~g~Divid~~G~~----~~-----------------------~~~~~~l~~~G~iv~~G~~~~~~~~~~~----  255 (332)
T Consensus       129 ~~~~G--~iDiLVNNAG~~~~~~~~~~~~~e~w~~~~~vNl~g~f~~~~aa~p~m~~gGsIInisSi~~~~~~~~~~~Y~  206 (300)
T PRK06128        129 VKELG--GLDILVNIAGKQTARKDIADITTEQFDATFKTNVYAMFWLCKAAIPHLPPGASIINTGSIQSYQPSPTLLDYA  206 (300)
T ss_pred             HHHHC--CCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCCEEEEEEEEEECCCCCCHHHH
T ss_conf             99809--9998998999977899917799999999986611589999999999875387147874212405788617789


Q ss_pred             -------------CCHHHCCCCEEEEEEECCCH-HCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHC
Q ss_conf             -------------43343053216777512400-0113789999999999999869831021247418999999999982
Q gi|254780290|r  256 -------------LNPIISKRITITGSTLRRRT-DIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEK  321 (332)
Q Consensus       256 -------------~~~~~~~~~~i~g~~~~~~~-~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~  321 (332)
T Consensus       207 asKaav~~lTrslA~ela~~gIRVNaVaPG~i~T~l~~~~~--~~~e~~~~~~~~---~P-lgR~g~PeEIA~~v~FLaS  280 (300)
T PRK06128        207 STKAAIVNFTKGLAQQVAEKGIRVNAVAPGPVWTPLQPSGG--QPPEKIPDFGSE---TP-MKRAGQPVEMAPLYVLLAS  280 (300)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCCCCC--CCHHHHHHHHHC---CC-CCCCCCHHHHHHHHHHHHC
T ss_conf             99999999999999997416979999961889871200169--999999999836---99-8998399999999999958


Q ss_pred             C---CCCCEEEE
Q ss_conf             9---98132898
Q gi|254780290|r  322 S---EHIGKIIL  330 (332)
Q Consensus       322 g---~~~GKvVi  330 (332)
T Consensus       281 d~asyiTGq~i~  292 (300)
T PRK06128        281 QESSYVTGEVFG  292 (300)
T ss_pred             CHHCCCCCCEEE
T ss_conf             242585585489