HHsearch alignment for GI: 254780290 and conserved domain: PRK06172

>PRK06172 short chain dehydrogenase; Provisional.
Probab=95.83  E-value=0.00068  Score=44.89  Aligned_cols=178  Identities=17%  Similarity=0.207  Sum_probs=90.1

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCCCCC---CCCCCC----CCCCCCCCCCCC
Q ss_conf             2222221134444432222212222222211122322111----11122332222---222221----111222222222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCL----ACLKLGAKHAI---NYLKED----FLEILQKETQGR  213 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~----~~~~lGa~~vi---~~~~~~----~~~~i~~~t~g~  213 (332)
T Consensus         6 ~gKvalVTGas~GIG~aiA~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~g~~~~~~~~Dvs~~~~v~~~~~~~~~~~-G-   83 (253)
T PRK06172          6 SGQVALVTGGAAGIGRATAIAFAREGAKVVVADRDAAGGEETVALIREAGGEALFIACDVTRDAEVKALVEKTIAAY-G-   83 (253)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHC-C-
T ss_conf             99989993757689999999999879989999798899999999999649937999818999999999999999982-9-


Q ss_pred             CCCCCCCCCCCC----CC-C----------------------CCCCCC--CCCCCCEEEEECCCCCCCCCC---------
Q ss_conf             111222211111----12-2----------------------222112--234530479833787543222---------
Q gi|254780290|r  214 GIDIILDMVGAE----YL-N----------------------QHLTLL--SKEGKLIIISFLGGNIATEIN---------  255 (332)
Q Consensus       214 g~Divid~~G~~----~~-~----------------------~~~~~l--~~~G~iv~~G~~~~~~~~~~~---------  255 (332)
T Consensus        84 ~iDiLVNNAGi~~~~~~~~~~~~e~w~~~~~vNl~g~~~~~~~~~~~m~~~~~G~IVnisS~~g~~~~~~~~~Y~asKaa  163 (253)
T PRK06172         84 RLDYAFNNAGIEIEQGRLAEGSEAEFDAIMGVNVKGVWLCMKYQIPLMLAQGGGAIVNTASVAGLGAAPKMSIYAASKHA  163 (253)
T ss_pred             CCCEEEECCCCCCCCCCCHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCHHHCCCCCCCHHHHHHHHH
T ss_conf             99999989888999999013999999999999739999999999999998599589997666647689997789999999


Q ss_pred             --------CCHHHCCCCEEEEEEECCCHHCCHHHHHHHH--HHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHCC---
Q ss_conf             --------4334305321677751240001137899999--999999998698310212474189999999999829---
Q gi|254780290|r  256 --------LNPIISKRITITGSTLRRRTDIAKQSIRDSL--QLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKS---  322 (332)
Q Consensus       256 --------~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~--~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~g---  322 (332)
T Consensus       164 l~~ltr~lA~e~a~~gIrVNaV~PG~i~---T~~~~~~~~~~~~~~~~~~~~--~Pl-~R~g~pediA~~v~FLaSd~a~  237 (253)
T PRK06172        164 VIGLTKSAAIEYAKKGIRVNAVCPAVID---TDMFRRAYEADPRKAEFAAAM--HPV-GRIGKVEEIANAVLYLCSDGAS  237 (253)
T ss_pred             HHHHHHHHHHHHHHHCCEEEEEEECCCC---CHHHHHHCCCCHHHHHHHHHC--CCC-CCCCCHHHHHHHHHHHHCCHHC
T ss_conf             9999999999863318789999779798---757764421899999999737--998-9985999999999999385326


Q ss_pred             CCCCEEEE
Q ss_conf             98132898
Q gi|254780290|r  323 EHIGKIIL  330 (332)
Q Consensus       323 ~~~GKvVi  330 (332)
T Consensus       238 ~iTG~~i~  245 (253)
T PRK06172        238 FTTGHSLM  245 (253)
T ss_pred             CCCCCEEE
T ss_conf             82598287