HHsearch alignment for GI: 254780290 and conserved domain: PRK06227

>PRK06227 consensus.
Probab=95.63  E-value=0.00091  Score=44.03  Aligned_cols=180  Identities=18%  Similarity=0.158  Sum_probs=89.8

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCCCCC---CCCCCCC----CCCCCCCCCCCC
Q ss_conf             222222113444443222221222222221112232211----11112233222---2222221----111222222222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKC----LACLKLGAKHA---INYLKED----FLEILQKETQGR  213 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~----~~~~~lGa~~v---i~~~~~~----~~~~i~~~t~g~  213 (332)
T Consensus         4 ~gKvalVTGas~GIG~aiA~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~g~~~~~~~~Dvs~~~~v~~~~~~~~~~~-G-   81 (256)
T PRK06227          4 SGKVAIVTGGGQGIGAAIAQTFAENGAKVVIADIDEEAGLEREEMLRSNGLDALFVKTDVSDEEDVKNMVRKTVERY-G-   81 (256)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHC-C-
T ss_conf             99889995866889999999999879999999698889999999999559918999816899999999999999982-9-


Q ss_pred             CCCCCCCCCCCC----C-------CC---------------CCCCCCC--CCCCCEEEEECCCCCCCCCC----------
Q ss_conf             111222211111----1-------22---------------2221122--34530479833787543222----------
Q gi|254780290|r  214 GIDIILDMVGAE----Y-------LN---------------QHLTLLS--KEGKLIIISFLGGNIATEIN----------  255 (332)
Q Consensus       214 g~Divid~~G~~----~-------~~---------------~~~~~l~--~~G~iv~~G~~~~~~~~~~~----------  255 (332)
T Consensus        82 ~iDiLVNNAGi~~~~~~~~~~~e~w~~~~~vNl~g~f~~~~~~~p~m~~~~~G~IVnisS~~~~~~~~~~~~Y~asKaav  161 (256)
T PRK06227         82 GIDILINNAGIFSGKSIFERTLEEWERVIRVNLTGPYLCSKYAAEEMIKNGGGVIINIASTRAFQSEPNTEPYSASKGGI  161 (256)
T ss_pred             CCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHHH
T ss_conf             99799989989999890349899999999998299999999999999984997799962255456899868899999999


Q ss_pred             -------CCHHHCCCCEEEEEEECCCHHCCH-HHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHCC---CC
Q ss_conf             -------433430532167775124000113-7899999999999998698310212474189999999999829---98
Q gi|254780290|r  256 -------LNPIISKRITITGSTLRRRTDIAK-QSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKS---EH  324 (332)
Q Consensus       256 -------~~~~~~~~~~i~g~~~~~~~~~~~-~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~g---~~  324 (332)
T Consensus       162 ~~lTr~lA~ela~~gIrVNaVaPG~i-~T~~~~~~~~~~~~~~~~~~~~~--~P-~gR~g~peeiA~~v~FL~Sd~as~i  237 (256)
T PRK06227        162 IALTHSLAVSLSKYKIRVVSISPGWI-ETSEWKKPPLRKKPQLTPLDHLQ--HP-AGRVGKPEDVANLCLFLASDEASFI  237 (256)
T ss_pred             HHHHHHHHHHHCCCCEEEEEEECCCC-CCCCCCCCCCCCCHHHHHHHHHC--CC-CCCCCCHHHHHHHHHHHHCCHHCCC
T ss_conf             99999999996202949999961869-66500057510257778878626--88-7798599999999999967632492


Q ss_pred             CCEEEE
Q ss_conf             132898
Q gi|254780290|r  325 IGKIIL  330 (332)
Q Consensus       325 ~GKvVi  330 (332)
T Consensus       238 TG~~i~  243 (256)
T PRK06227        238 TGVNFI  243 (256)
T ss_pred             CCCEEE
T ss_conf             586389