HHsearch alignment for GI: 254780290 and conserved domain: PRK06346

>PRK06346 consensus.
Probab=94.84  E-value=0.0016  Score=42.38  Aligned_cols=181  Identities=16%  Similarity=0.196  Sum_probs=90.8

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CC---CCCC---CCCCCCCCC----CCCCCCCCCCCC
Q ss_conf             222222113444443222221222222221112232211111-12---2332---222222221----111222222222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC-LK---LGAK---HAINYLKED----FLEILQKETQGR  213 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~-~~---lGa~---~vi~~~~~~----~~~~i~~~t~g~  213 (332)
T Consensus         4 ~gKv~lITGgs~GIG~a~a~~la~~Ga~V~i~~r~~e~~~~~~~~l~~~~~~~~~~~~Dv~~~~~v~~~i~~~~~~f-g-   81 (251)
T PRK06346          4 KGKVAIVTGAASGMGKSIAELFAKEGAKVVVADLNLERAQKVVEEITSNGGTAIAVVANVTKQEDIENMVDTAVDTY-G-   81 (251)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHC-C-
T ss_conf             99889994757889999999999879989999798999999999999639908999778898999999999999982-9-


Q ss_pred             CCCCCCCCCCC--C--C--------CC---------------CCCCCC--CCCCCCEEEEECCCCCCCCCC---------
Q ss_conf             11122221111--1--1--------22---------------222112--234530479833787543222---------
Q gi|254780290|r  214 GIDIILDMVGA--E--Y--------LN---------------QHLTLL--SKEGKLIIISFLGGNIATEIN---------  255 (332)
Q Consensus       214 g~Divid~~G~--~--~--------~~---------------~~~~~l--~~~G~iv~~G~~~~~~~~~~~---------  255 (332)
T Consensus        82 ~iDiLVnNAgi~~~~~~~~~~~~e~w~~~~~vNl~g~~~~~~~~~p~m~~~~~G~IInisS~~~~~~~~~~~~Y~asK~a  161 (251)
T PRK06346         82 TLDILVNNAGIMDNFVPVGELTDELWDKVFAVNTTGVMRATRKALPIFEEKGSGVIVNIASVGGLNGSRAGAAYTASKHA  161 (251)
T ss_pred             CCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHCCCCCCCHHHHHHHHH
T ss_conf             99799989988999987112899999999999709999999999999998599549999456547889887589999999


Q ss_pred             --------CCHHHCCCCEEEEEEECCCHHCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHCC---CC
Q ss_conf             --------4334305321677751240001137899999999999998698310212474189999999999829---98
Q gi|254780290|r  256 --------LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKS---EH  324 (332)
Q Consensus       256 --------~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~g---~~  324 (332)
T Consensus       162 l~~ltr~lA~e~a~~gIrvN~I~PG~i~T~~~~~~~~~~~~~~~~~~~~~~~~~---R~g~pediA~~v~fL~Sd~s~~i  238 (251)
T PRK06346        162 VIGLTKNTGFMYANKGIRCNAIAPGAVNTNIGTTITAPDEFGQERAMAGMGTNP---RAGQAEEIAQVALFLASDDASFV  238 (251)
T ss_pred             HHHHHHHHHHHHHHCCEEEEEEEECCCCCCHHHHCCCCCHHHHHHHHHCCCCCC---CCCCHHHHHHHHHHHHCCHHCCC
T ss_conf             999999999986241959999876889772333124789779998862488889---87689999999999957153593


Q ss_pred             CCEEEE
Q ss_conf             132898
Q gi|254780290|r  325 IGKIIL  330 (332)
Q Consensus       325 ~GKvVi  330 (332)
T Consensus       239 TG~~i~  244 (251)
T PRK06346        239 NGTVIT  244 (251)
T ss_pred             CCCEEE
T ss_conf             686288