HHsearch alignment for GI: 254780290 and conserved domain: PRK06949

>PRK06949 short chain dehydrogenase; Provisional.
Probab=95.02  E-value=0.0019  Score=41.98  Aligned_cols=78  Identities=24%  Similarity=0.334  Sum_probs=51.1

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCC---CCCCCCC----CCCCCCCCCCCC
Q ss_conf             222222113444443222221222222221112232211111----12233222---2222221----111222222222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC----LKLGAKHA---INYLKED----FLEILQKETQGR  213 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~----~~lGa~~v---i~~~~~~----~~~~i~~~t~g~  213 (332)
T Consensus         8 ~gKvalVTGas~GIG~aiA~~la~~Ga~V~i~~~~~~~~~~~~~~i~~~g~~~~~~~~Dv~~~~~v~~~v~~~~~~~G--   85 (258)
T PRK06949          8 EGKVALVTGASSGLGQRFAQVLSQAGAKVVLASRRVERLKELRAEIEAEGGAAHVVSLDVTDYQSIKAAVAHAETEAG--   85 (258)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHC--
T ss_conf             999899958577999999999998799999996988999999999996599289998268999999999999999849--


Q ss_pred             CCCCCCCCCCC
Q ss_conf             11122221111
Q gi|254780290|r  214 GIDIILDMVGA  224 (332)
Q Consensus       214 g~Divid~~G~  224 (332)
T Consensus        86 ~iDiLVnnAG~   96 (258)
T PRK06949         86 TIDILVNNSGV   96 (258)
T ss_pred             CCCEEEECCCC
T ss_conf             99899989988