HHsearch alignment for GI: 254780290 and conserved domain: PRK07097

>PRK07097 gluconate 5-dehydrogenase; Provisional.
Probab=95.13  E-value=0.0013  Score=43.02  Aligned_cols=181  Identities=19%  Similarity=0.195  Sum_probs=93.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCC---CCCCCCCCC----CCCCCCCCCCCC
Q ss_conf             222222113444443222221222222221112232211111----122332---222222221----111222222222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC----LKLGAK---HAINYLKED----FLEILQKETQGR  213 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~----~~lGa~---~vi~~~~~~----~~~~i~~~t~g~  213 (332)
T Consensus         9 ~gK~alVTG~s~GIG~aiA~~la~~Ga~Vii~~~~~~~~~~~~~~~~~~g~~~~~~~~Dvt~~~~v~~~~~~~~~~~g--   86 (265)
T PRK07097          9 KGKIALITGASYGIGFAIAKAYAEAGATIVFNDIKQELVDKGLAAYRELGIEAHGYVCDVTDEDGIQAMVAQIEKEVG--   86 (265)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHCC--
T ss_conf             999899958576899999999998699999995998999999999995499179999328999999999999999829--


Q ss_pred             CCCCCCCCCCCC---C--------CC---------------CCCCCC--CCCCCCEEEEECCCCCCCCCC----------
Q ss_conf             111222211111---1--------22---------------222112--234530479833787543222----------
Q gi|254780290|r  214 GIDIILDMVGAE---Y--------LN---------------QHLTLL--SKEGKLIIISFLGGNIATEIN----------  255 (332)
Q Consensus       214 g~Divid~~G~~---~--------~~---------------~~~~~l--~~~G~iv~~G~~~~~~~~~~~----------  255 (332)
T Consensus        87 ~iDiLVnNAG~~~~~~~~~~~~e~~~~~~~vNl~g~~~~~~~~~~~m~~~~~G~IVnisS~~~~~~~~~~~~Y~asKaav  166 (265)
T PRK07097         87 VIDILVNNAGIIRRIPMLEMSAEDFRQVIDIDLNAPFIVSKAVLPSMIKKGHGKIINICSMMSELGRETVSAYAAAKGGL  166 (265)
T ss_pred             CCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECHHHCCCCCCCHHHHHHHHHH
T ss_conf             99899989989999882659999999999986072899999999989980897599990521156788866899999999


Q ss_pred             -------CCHHHCCCCEEEEEEECCCHHCCHHHHHH----HHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHCC--
Q ss_conf             -------43343053216777512400011378999----99999999998698310212474189999999999829--
Q gi|254780290|r  256 -------LNPIISKRITITGSTLRRRTDIAKQSIRD----SLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKS--  322 (332)
Q Consensus       256 -------~~~~~~~~~~i~g~~~~~~~~~~~~~~~~----~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~g--  322 (332)
T Consensus       167 ~~ltr~lA~e~a~~gIrVN~V~PG~i~T~~~~~~~~~~~~~~~~~~~~~~~~~--~P-~~R~g~p~dia~~v~FL~Sd~s  243 (265)
T PRK07097        167 KMLTKNIASEYGEANIQCNGIGPGYIATPQTAPLRERQADGSRHPFDQFIIAK--TP-AARWGTPEDLAGPAVFLASDAS  243 (265)
T ss_pred             HHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHHC--CC-CCCCCCHHHHHHHHHHHHCCHH
T ss_conf             99999999997024959999965889886304566531011121599999847--99-8897889999999999948442


Q ss_pred             -CCCCEEEE
Q ss_conf             -98132898
Q gi|254780290|r  323 -EHIGKIIL  330 (332)
Q Consensus       323 -~~~GKvVi  330 (332)
T Consensus       244 ~~iTGq~i~  252 (265)
T PRK07097        244 NFVNGHILY  252 (265)
T ss_pred             CCCCCCEEE
T ss_conf             483587599