HHsearch alignment for GI: 254780290 and conserved domain: PRK07825

>PRK07825 short chain dehydrogenase; Provisional.
Probab=96.25  E-value=0.00024  Score=47.81  Aligned_cols=104  Identities=22%  Similarity=0.416  Sum_probs=65.2

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCC--CCCCCCCC----CCCCCCCCCCCCCCCC
Q ss_conf             22222211344444322222122222222111223221111-11223322--22222221----1112222222221112
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLA-CLKLGAKH--AINYLKED----FLEILQKETQGRGIDI  217 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~-~~~lGa~~--vi~~~~~~----~~~~i~~~t~g~g~Di  217 (332)
T Consensus         4 ~gKvvlITGassGIG~a~A~~la~~Ga~V~i~~r~~~~l~~~~~~~~~~~~~~~DVtd~~~v~~~~~~~~~~~--G~iDi   81 (273)
T PRK07825          4 RGKVIAITGGARGIGLATARALAALGAKVAIGDLDEALAKESAAELGLVVGGPLDVTDPASFAAFLDAVEADL--GPIDV   81 (273)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHH--CCCCE
T ss_conf             9988999262339999999999987998999979999999999860785599914799999999999999970--99778


Q ss_pred             CCCCCCCC----CCC----------------------CCCCCC--CCCCCCEEEEECCCCC
Q ss_conf             22211111----122----------------------222112--2345304798337875
Q gi|254780290|r  218 ILDMVGAE----YLN----------------------QHLTLL--SKEGKLIIISFLGGNI  250 (332)
Q Consensus       218 vid~~G~~----~~~----------------------~~~~~l--~~~G~iv~~G~~~~~~  250 (332)
T Consensus        82 LVNNAGi~~~~~~~e~~~e~~~~~~~vNl~g~~~~~~~~lp~M~~~~~G~IVnisS~ag~~  142 (273)
T PRK07825         82 LVNNAGIMPVGPFLDEPDRATRRILDVNVYGVILGSKLAAPRMVPRGRGHIVNVASLAGKI  142 (273)
T ss_pred             EEECCCCCCCCCHHHCCHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCCCEEEEEECHHHHC
T ss_conf             9987877899873439999999998860399999999999999973994799984767647