HHsearch alignment for GI: 254780290 and conserved domain: PRK07985

>PRK07985 oxidoreductase; Provisional.
Probab=96.08  E-value=0.00056  Score=45.45  Aligned_cols=186  Identities=18%  Similarity=0.197  Sum_probs=90.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--C----CCCCCCCCCCCC---CCCCCCCCCCCCCC
Q ss_conf             22222222222211344444322222122222222111223221--1----111122332222---22222111122222
Q gi|254780290|r  139 QTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEK--C----LACLKLGAKHAI---NYLKEDFLEILQKE  209 (332)
Q Consensus       139 ~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~--~----~~~~~lGa~~vi---~~~~~~~~~~i~~~  209 (332)
T Consensus        43 ~~GrL-~gKvalVTGas~GIG~aiA~~lA~~GA~Vvi~~~~~~~~~a~~~~~~~~~~g~~~~~~~~Dvs~~~~v~~lv~~  121 (294)
T PRK07985         43 GSGRL-KDRKALVTGGDSGIGRAAAIAYAREGADVAISYLPVEEEDAQDVKKIIEECGRKAVLLPGDLSDEKFARSLVHE  121 (294)
T ss_pred             CCCCC-CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHH
T ss_conf             77778-99979991726699999999999879999994299666789999999997299589997678999999999999


Q ss_pred             CCC--CCCCCCCCCCCCC---------------------------CCCCCCCCCCCCCCCEEEEECCCCCCCCCC-----
Q ss_conf             222--2111222211111---------------------------122222112234530479833787543222-----
Q gi|254780290|r  210 TQG--RGIDIILDMVGAE---------------------------YLNQHLTLLSKEGKLIIISFLGGNIATEIN-----  255 (332)
Q Consensus       210 t~g--~g~Divid~~G~~---------------------------~~~~~~~~l~~~G~iv~~G~~~~~~~~~~~-----  255 (332)
T Consensus       122 ~~~~fG~iDiLVnnAG~~~~~~~~~~~s~e~~~~~~~vNl~g~~~~~qaa~p~m~~gGsIInisS~~~~~~~p~~~~Y~a  201 (294)
T PRK07985        122 AHKALGGLDIMALVAGKQVAIPDIADLTSEQFQKTFAINVFALFWLTQEAIPLLPKGASIITTSSIQAYQPSPHLLDYAA  201 (294)
T ss_pred             HHHHHCCCCEEEEECCCCCCCCCHHHCCHHHHHHHHHHHCHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHH
T ss_conf             99985998889980666668888365899999999998653478888876776424877999666465278887307799


Q ss_pred             ------------CCHHHCCCCEEEEEEECCCHHCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHCC-
Q ss_conf             ------------4334305321677751240001137899999999999998698310212474189999999999829-
Q gi|254780290|r  256 ------------LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKS-  322 (332)
Q Consensus       256 ------------~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~g-  322 (332)
T Consensus       202 sKaav~~lTrslA~Ela~~gIRVN~IaPG~i~T~--~~~~~~~~~~~~~~~~~~--~P-l~R~g~peDIA~av~fLaS~~  276 (294)
T PRK07985        202 TKAAILNYSRGLAKQVAEKGIRVNIVAPGPIWTA--LQISGGQTQDKIPQFGQQ--TP-MKRAGQPAELAPVYVYLASQE  276 (294)
T ss_pred             HHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCC--CHHCCCCCHHHHHHHHHC--CC-CCCCCCHHHHHHHHHHHHCCH
T ss_conf             9999999999999996533929999963878771--020279999999999856--99-889939999999999995824


Q ss_pred             --CCCCEEEE
Q ss_conf             --98132898
Q gi|254780290|r  323 --EHIGKIIL  330 (332)
Q Consensus       323 --~~~GKvVi  330 (332)
T Consensus       277 a~~ITGq~i~  286 (294)
T PRK07985        277 SSYVTAEVHG  286 (294)
T ss_pred             HCCCCCCEEE
T ss_conf             3672672279