HHsearch alignment for GI: 254780290 and conserved domain: PRK08159

>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional.
Probab=93.84  E-value=0.0041  Score=39.74  Aligned_cols=182  Identities=18%  Similarity=0.223  Sum_probs=87.7

Q ss_pred             CCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCCCCCC--CCCCCCCC----CCCCCC
Q ss_conf             222222222113444--443222221222222221112232211----111122332222--22222111----122222
Q gi|254780290|r  142 NLRSGQTVLIHGGSS--GIGTTAIQLASYFGATVYTTAKSEEKC----LACLKLGAKHAI--NYLKEDFL----EILQKE  209 (332)
Q Consensus       142 ~~~~g~~vlV~ga~g--~vG~~a~qla~~~G~~vi~~~~~~~~~----~~~~~lGa~~vi--~~~~~~~~----~~i~~~  209 (332)
T Consensus         6 g~L~GK~alITGaag~~GIG~aiA~~la~~GA~V~i~~~~~~~~~~~~~l~~~~g~~~~~~~Dvtd~~~v~~~v~~~~~~   85 (272)
T PRK08159          6 GLMQGKRGLILGVANNRSIAWGIAKACRAAGAELAFTYQGDALKKRVEPLAAELGAFVVGHCDVTDEASIDAVFETLEKK   85 (272)
T ss_pred             CCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHH
T ss_conf             23589999998899986899999999998699999974866899999999986498189983789999999999999998


Q ss_pred             CCCCCCCCCCCCCCCC-----------C----C---------------CCCCCCCCCCCCCEEEEECCCCCCC-CCC---
Q ss_conf             2222111222211111-----------1----2---------------2222112234530479833787543-222---
Q gi|254780290|r  210 TQGRGIDIILDMVGAE-----------Y----L---------------NQHLTLLSKEGKLIIISFLGGNIAT-EIN---  255 (332)
Q Consensus       210 t~g~g~Divid~~G~~-----------~----~---------------~~~~~~l~~~G~iv~~G~~~~~~~~-~~~---  255 (332)
T Consensus        86 ~-G-~iDiLVnnag~~~~~~~~~~~~d~~~~~~~~~~~vn~~~~~~~~~~~~~~m~~ggsIv~iss~~~~~~~p~~~~y~  163 (272)
T PRK08159         86 W-G-KLDFVVHAIGFSDKDELTGRYVDTSEDNFSMTMLISVYSLTAVAQRAEKLMTDGGSILTLTYYGAEKVMPHYNVMG  163 (272)
T ss_pred             H-C-CCCEEEECCCCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCHHH
T ss_conf             6-9-9788985354466644566543288999999998886899999988765404787034787541233477520256


Q ss_pred             -------------CCHHHCCCCEEEEEEECCCHHCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHC-
Q ss_conf             -------------433430532167775124000113789999999999999869831021247418999999999982-
Q gi|254780290|r  256 -------------LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEK-  321 (332)
Q Consensus       256 -------------~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~-  321 (332)
T Consensus       164 ~sKaAl~~ltr~lA~elg~~gIRVNaVaPG~i~T~~~~~~~-~~-~~~~~~~~~~--~p-l~R~g~pedvA~av~fL~Sd  238 (272)
T PRK08159        164 VAKAALEASVRYLAVDLGPKNIRVNAISAGPIKTLAASGIG-DF-RYILKWNEYN--AP-LRRTVTIEEVGDSALYLLSD  238 (272)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCHHCCCC-CH-HHHHHHHHHC--CC-CCCCCCHHHHHHHHHHHHCC
T ss_conf             78999999999999975789989999863777771000487-78-9999868737--99-78984999999999999586


Q ss_pred             --CCCCCEEEE
Q ss_conf             --998132898
Q gi|254780290|r  322 --SEHIGKIIL  330 (332)
Q Consensus       322 --g~~~GKvVi  330 (332)
T Consensus       239 ~s~~iTGq~l~  249 (272)
T PRK08159        239 LSRGVTGEVHH  249 (272)
T ss_pred             HHCCCCCCEEE
T ss_conf             21585487088