HHsearch alignment for GI: 254780290 and conserved domain: PRK08226

>PRK08226 short chain dehydrogenase; Provisional.
Probab=95.61  E-value=0.00065  Score=45.01  Aligned_cols=78  Identities=23%  Similarity=0.319  Sum_probs=50.7

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC---CCCCC---CCCCCCCC----CCCCCCCCCCCCC
Q ss_conf             22222211344444322222122222222111223221111112---23322---22222221----1112222222221
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLK---LGAKH---AINYLKED----FLEILQKETQGRG  214 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~---lGa~~---vi~~~~~~----~~~~i~~~t~g~g  214 (332)
T Consensus         5 ~gKvalVTGas~GIG~aiA~~la~~Ga~Vvi~d~~~~~~~~~~~~~~~g~~~~~~~~Dvsd~~~v~~~v~~~~~~~-G-~   82 (263)
T PRK08226          5 TGKTALITGALQGIGEGIARVFARHGANLILLDISPEIEKLADELCGRGHRCTAVVADVRDPASVAAAIKRAKEKE-G-R   82 (263)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHH-C-C
T ss_conf             9988999473779999999999987998999969879999999998369917999941799999999999999983-9-9


Q ss_pred             CCCCCCCCCC
Q ss_conf             1122221111
Q gi|254780290|r  215 IDIILDMVGA  224 (332)
Q Consensus       215 ~Divid~~G~  224 (332)
T Consensus        83 iDiLVNNAGi   92 (263)
T PRK08226         83 IDILVNNAGV   92 (263)
T ss_pred             CCEEEECCCC
T ss_conf             8699989977