HHsearch alignment for GI: 254780290 and conserved domain: PRK08267

>PRK08267 short chain dehydrogenase; Provisional.
Probab=96.39  E-value=0.00017  Score=48.94  Aligned_cols=104  Identities=22%  Similarity=0.271  Sum_probs=65.2

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCC----CCCCCCCC-CCCCCCCCC--CCCCCCC
Q ss_conf             2222113444443222221222222221112232211111-12233222----22222211-112222222--2211122
Q gi|254780290|r  147 QTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC-LKLGAKHA----INYLKEDF-LEILQKETQ--GRGIDII  218 (332)
Q Consensus       147 ~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~-~~lGa~~v----i~~~~~~~-~~~i~~~t~--g~g~Div  218 (332)
T Consensus         2 K~vlITGassGIG~a~A~~~a~~G~~V~~~~r~~~~l~~~~~~l~~~~~~~~~~Dvtd~~~v~~~~~~~~~~~~G~iDiL   81 (258)
T PRK08267          2 KSIFITGAASGIGRATARLFAARGWRVGAYDINEDGLAALAAELGAERAWTGALDVTDRAAWDAALADFCAATGGRLDVL   81 (258)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCCCEE
T ss_conf             98999072268999999999987999999988899999999983699679999117999999999999999958998689


Q ss_pred             CCCCCCC---CCC-----------------------CCCCCCC--CCCCCEEEEECCCCC
Q ss_conf             2211111---122-----------------------2221122--345304798337875
Q gi|254780290|r  219 LDMVGAE---YLN-----------------------QHLTLLS--KEGKLIIISFLGGNI  250 (332)
Q Consensus       219 id~~G~~---~~~-----------------------~~~~~l~--~~G~iv~~G~~~~~~  250 (332)
T Consensus        82 VNNAGi~~~~~~~~~~~e~~~~~~~vNl~g~~~~~~~~lp~m~~~~~g~IvnisS~~g~~  141 (258)
T PRK08267         82 FNNAGILRGGPFEDIPLEAHDRVIDINVKGVLNGAYAALPYLKATPGARVINTSSASAIY  141 (258)
T ss_pred             EECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHCC
T ss_conf             988877999882449999999999997399999999999999977992799990654467