HHsearch alignment for GI: 254780290 and conserved domain: PRK08287

>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated.
Probab=93.39  E-value=0.018  Score=35.49  Aligned_cols=100  Identities=18%  Similarity=0.216  Sum_probs=64.2

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222222222221134444432222212222-222211122322111111----22332222222221111222222222
Q gi|254780290|r  139 QTANLRSGQTVLIHGGSSGIGTTAIQLASYF-GATVYTTAKSEEKCLACL----KLGAKHAINYLKEDFLEILQKETQGR  213 (332)
Q Consensus       139 ~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~-G~~vi~~~~~~~~~~~~~----~lGa~~vi~~~~~~~~~~i~~~t~g~  213 (332)
T Consensus        24 skL~l~~~~vvwDIGa--GsGsvsiEaa~~~p~~~V~AvE~~~~~~~~i~~N~~~fg~~nv~~-i~g~Ap~~l~~-----   95 (186)
T PRK08287         24 SKLELHRAKHLIDVGA--GTGSVSIEAALQFPSLQVTAIERNPAALRLIKENRQRFGCGNIDI-IPGEAPITLTG-----   95 (186)
T ss_pred             HHCCCCCCCEEEEECC--CCCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCEEE-EECCCCHHCCC-----
T ss_conf             9719999999999578--877899999997899889999379899999999899729998799-93778110357-----


Q ss_pred             CCCCCCCCC-CC---CCCCCCCCCCCCCCCCEEEEEC
Q ss_conf             111222211-11---1122222112234530479833
Q gi|254780290|r  214 GIDIILDMV-GA---EYLNQHLTLLSKEGKLIIISFL  246 (332)
Q Consensus       214 g~Divid~~-G~---~~~~~~~~~l~~~G~iv~~G~~  246 (332)
T Consensus        96 ~pD~vFIGGsgg~l~~il~~~~~~L~~gGriVinavt  132 (186)
T PRK08287         96 KADAIFMGGSGGHLTAIIDWALGHLHPGGRLVLNFIL  132 (186)
T ss_pred             CCCEEEEECCCCCHHHHHHHHHHHCCCCCEEEEEEEE
T ss_conf             8984999747898899999999757999899998260