HHsearch alignment for GI: 254780290 and conserved domain: PRK08317

>PRK08317 hypothetical protein; Provisional.
Probab=95.90  E-value=0.00074  Score=44.62  Aligned_cols=103  Identities=18%  Similarity=0.227  Sum_probs=67.5

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCCC
Q ss_conf             112222222222221134444432222212222--222211122322111111223322--2222222111122222222
Q gi|254780290|r  137 LFQTANLRSGQTVLIHGGSSGIGTTAIQLASYF--GATVYTTAKSEEKCLACLKLGAKH--AINYLKEDFLEILQKETQG  212 (332)
Q Consensus       137 l~~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~--G~~vi~~~~~~~~~~~~~~lGa~~--vi~~~~~~~~~~i~~~t~g  212 (332)
T Consensus        11 ~l~~L~l~pG~~vLDiG--cG~G~~~~~la~~~g~~~~v~gvD~s~~~l~~a~~~~~~~~~~v~~~~~d~~~-l-p~-~d   85 (241)
T PRK08317         11 TFELLAVQPGERVLDVG--CGPGNDLRELADRVGPEGRVVGIDRSEAMLALARERAAGLLSNVEFVRGDADG-L-PF-PD   85 (241)
T ss_pred             HHHHCCCCCCCEEEEEC--CCCCHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCHHH-C-CC-CC
T ss_conf             99736999979999966--41749999999974999789999698899999999986228964999554643-5-89-88


Q ss_pred             CCCCCCCCCCC-------CCCCCCCCCCCCCCCCCEEEE
Q ss_conf             21112222111-------111222221122345304798
Q gi|254780290|r  213 RGIDIILDMVG-------AEYLNQHLTLLSKEGKLIIIS  244 (332)
Q Consensus       213 ~g~Divid~~G-------~~~~~~~~~~l~~~G~iv~~G  244 (332)
T Consensus        86 ~sfD~v~~~~~l~h~~d~~~~l~e~~RvLkPGG~~vi~d  124 (241)
T PRK08317         86 ESFDAVRSDRVLQHLEDPRRALAEMARVLRPGGRAVVLD  124 (241)
T ss_pred             CCCCEEEHHHHHHHCCCHHHHHHHHHHHCCCCCEEEEEE
T ss_conf             870456221157622589999999999818883899996