HHsearch alignment for GI: 254780290 and conserved domain: PRK08415

>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional.
Probab=94.52  E-value=0.0025  Score=41.12  Aligned_cols=102  Identities=25%  Similarity=0.337  Sum_probs=58.6

Q ss_pred             CCCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCCCCCC--CCCCCC----CCCCCCCCCCC
Q ss_conf             222222113444--443222221222222221112232211----111122332222--222221----11122222222
Q gi|254780290|r  145 SGQTVLIHGGSS--GIGTTAIQLASYFGATVYTTAKSEEKC----LACLKLGAKHAI--NYLKED----FLEILQKETQG  212 (332)
Q Consensus       145 ~g~~vlV~ga~g--~vG~~a~qla~~~G~~vi~~~~~~~~~----~~~~~lGa~~vi--~~~~~~----~~~~i~~~t~g  212 (332)
T Consensus         4 ~GK~alITGaag~~GIG~aiA~~la~~GA~V~i~~~~~~~~~~~~~l~~~~g~~~~~~~Dvs~~~~v~~~~~~i~~~~--   81 (274)
T PRK08415          4 KGKKGLIVGVANNKSIAYGIAKACFEQGAELAFTYLNDALKKRVEPIAQELGSPYVYELDVSKEEHFKSLAESIKKDL--   81 (274)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH--
T ss_conf             998799989999837999999999986999999848878999999999862997699902899999999999999985--


Q ss_pred             CCCCCCCCCCCCC---------------CCC---------------CCCCCCCCCCCCEEEEECCC
Q ss_conf             2111222211111---------------122---------------22211223453047983378
Q gi|254780290|r  213 RGIDIILDMVGAE---------------YLN---------------QHLTLLSKEGKLIIISFLGG  248 (332)
Q Consensus       213 ~g~Divid~~G~~---------------~~~---------------~~~~~l~~~G~iv~~G~~~~  248 (332)
T Consensus        82 G~iDilVnnag~~~~~~~~~~~~d~~~~~~~~~~~~n~~~~~~~~~~~~~~m~~~GsIi~iss~~~  147 (274)
T PRK08415         82 GEIDFIVHSVAFAPKEALEGSFLETSKEAFDIAMEISVYSLIELTRALLPLLNDGGSVLTLSYLGG  147 (274)
T ss_pred             CCCCEEEECCCCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCC
T ss_conf             898888533555764334687333899999999999999999999999987430798764220246