HHsearch alignment for GI: 254780290 and conserved domain: PRK08642

>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional.
Probab=94.36  E-value=0.0029  Score=40.73  Aligned_cols=78  Identities=22%  Similarity=0.313  Sum_probs=48.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CC-CCCCCCCCCCC---CCCCCCC----CCCCCCCCCCCCCC
Q ss_conf             2222221134444432222212222222211122322-11-11112233222---2222221----11122222222211
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEE-KC-LACLKLGAKHA---INYLKED----FLEILQKETQGRGI  215 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~-~~-~~~~~lGa~~v---i~~~~~~----~~~~i~~~t~g~g~  215 (332)
T Consensus         5 ~gK~alVTGas~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~~~~~v~~~~~~-~G~~i   83 (254)
T PRK08642          5 SEQIVLVTGGSRGLGAAIARAFAREGARVVVNYHRSEDAAEALADELGDRAIAIQADVTDRNQVDAMFATATEH-FGKPI   83 (254)
T ss_pred             CCCEEEEECHHHHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHHH-HCCCC
T ss_conf             98999997811199999999999879999996189889999999981994699980699999999999999999-49977


Q ss_pred             CCCCCCCC
Q ss_conf             12222111
Q gi|254780290|r  216 DIILDMVG  223 (332)
Q Consensus       216 Divid~~G  223 (332)
T Consensus        84 dilVnnA~   91 (254)
T PRK08642         84 TTVVNNAL   91 (254)
T ss_pred             EEEEECCE
T ss_conf             69986764