HHsearch alignment for GI: 254780290 and conserved domain: PRK08643

>PRK08643 acetoin reductase; Validated.
Probab=94.21  E-value=0.0029  Score=40.67  Aligned_cols=77  Identities=18%  Similarity=0.239  Sum_probs=50.1

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCC---CCCCCCC----CCCCCCCCCCCCC
Q ss_conf             22222113444443222221222222221112232211111----12233222---2222221----1112222222221
Q gi|254780290|r  146 GQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC----LKLGAKHA---INYLKED----FLEILQKETQGRG  214 (332)
Q Consensus       146 g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~----~~lGa~~v---i~~~~~~----~~~~i~~~t~g~g  214 (332)
T Consensus         2 nKvalVTGg~~GIG~aia~~la~~Ga~V~i~d~~~~~~~~~~~~~~~~~~~~~~~~~Dvt~~~~v~~~~~~~~~~~G--~   79 (256)
T PRK08643          2 SKVALVTGAGQGIGFAIAKRLVEDGFKVAIVDYNEETAKAAADKLSSDGGKAIAVKADVSNRDQVFDAVQQVVDTFG--D   79 (256)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHHC--C
T ss_conf             84999957578899999999998799999996988999999999985399099998058999999999999999829--9


Q ss_pred             CCCCCCCCCC
Q ss_conf             1122221111
Q gi|254780290|r  215 IDIILDMVGA  224 (332)
Q Consensus       215 ~Divid~~G~  224 (332)
T Consensus        80 iDiLVNnAG~   89 (256)
T PRK08643         80 LNVVVNNAGL   89 (256)
T ss_pred             CCEEEECCCC
T ss_conf             8799989988